DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: axed and Btbd6

Sequence 1:NP_001356975.1 Gene:axed FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_964008.2 Gene:Btbd6 MGIID:3026623 Length:539 Species:Mus musculus

Alignment Length:340 Identity:79/341 (23%)
Similarity:124/341 (36%) Gaps:87/341 (26%)


  Fly   122 APAPSAP-PAHMMPPAYARGQTNIYTGVPIIVNPYIDFIVVNGDDRYMIRCERKSVLERSVELAK 185
            ||||..| ||   ||            :|...||...    |....:....||.:::..: ||..
Mouse    93 APAPLPPLPA---PP------------LPDNNNPESP----NWQSFHPTLRERNALMFNN-ELMA 137

  Fly   186 LIH---AGPNSGRKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLKILELSDRFNVPDLI 247
            .:|   ....:.|:...|..:|.|..:.|         :.:.|.|      :.|:....::||  
Mouse   138 DVHFIVGALGAARRVPAHKYVLAVGSSVF---------YAMFYGD------LAEVKSEIHIPD-- 185

  Fly   248 IYCIRELDLRISSATALDIFKALWFYQGIALTNQHQTVITTQETGQQLARKKATKAKAAAKQL-- 310
                      :..|..|.:.|.::..:   :..:..||:.|              ..||.|.:  
Mouse   186 ----------VEPAAFLVLLKYMYSDE---IDLEADTVLAT--------------LYAAKKYIVP 223

  Fly   311 AAAKASQS-TENGAEGDGA-----QQNLIPNPNPFTTEDYGVALLHNTLQLIDMHAELQLSMPEI 369
            |.|||..: .|...|...|     |..|...|.          |.....::||..||:.|.....
Mouse   224 ALAKACVNFLETSLEAKNACVLLSQSRLFEEPE----------LTQRCWEVIDAQAEMALRSEGF 278

  Fly   370 SDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAECARKHIDATPENRRTVLGPLCLTPRYLRM 434
            .::..:.||.:|.|:.|..: |..:||.:..|:.|||.|:.:..||.|:|.|||......|...|
Mouse   279 CEIDRQTLEIIVTREALNTK-EAVVFEAVLNWAEAECKRQGLPVTPHNKRHVLGRALYLVRIPTM 342

  Fly   435 TASEFRRCCERLELL 449
            |..||.....:.::|
Mouse   343 TLEEFANGAAQSDIL 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 None
Btbd6NP_964008.2 BTB 130..233 CDD:279045 26/148 (18%)
BTB 138..237 CDD:197585 25/143 (17%)
BACK 243..349 CDD:197943 34/117 (29%)
PHR 394..537 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45774
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.