DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: axed and BTBD17

Sequence 1:NP_001356975.1 Gene:axed FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_011523093.1 Gene:BTBD17 HGNCID:33758 Length:479 Species:Homo sapiens

Alignment Length:392 Identity:72/393 (18%)
Similarity:117/393 (30%) Gaps:146/393 (37%)


  Fly   171 CERKSVLERSVELAKL----IHAGPNSGRKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHL 231
            |......:....||.|    ...|..:...|.||.|.:                          |
Human    13 CREPETFQGEARLALLGAQRADVGGEAAGTSINHSQAV--------------------------L 51

  Fly   232 LKILELSDRFNVPDLIIYCIRELDLRISSA--TALDIFKALWFYQGI-------ALTNQHQ---- 283
            .::.||..:.|..|::        ||:.:|  ..:.:|.|.....|:       .|:||.:    
Human    52 QRLQELLRQGNASDVV--------LRVQAAGTDEVRVFHAHRLLLGLHSELFLELLSNQSEAVLQ 108

  Fly   284 ---------------------TVITTQETGQQLARKKATKAKAAAKQLAAAKASQSTENGAEGDG 327
                                 ||:.||...   ..:.|||...::.|...|...::...|..|..
Human   109 EPQDCAAVFDKFIRYLYCGELTVLLTQAIP---LHRLATKYGVSSLQRGVADYMRAHLAGGAGPA 170

  Fly   328 AQQNLIPNPNPFTTEDYGV-----ALLHNTLQLIDMHAELQLSMPEISDLRFEELETLVKRDTLQ 387
            .           ....|.|     ||..:.||.:..:.....:..|...:..|.|..|::|..|.
Human   171 V-----------GWYHYAVGTGDEALRESCLQFLAWNLSAVAASTEWGAVSPELLWQLLQRSDLV 224

  Fly   388 LRSEVTLFECLATWSLAECARKHIDATPENRRTVLG----PLCLTPRYLRMTASEFRRCCERLEL 448
            |:.|:.||..|..|                    ||    |..:..|.||..         |..:
Human   225 LQDELELFHALEAW--------------------LGRARPPPAVAERALRAI---------RYPM 260

  Fly   449 LPPTEISLITD-----ALDGKKLKNLTDQQAELLEKFRQPRAEYARMPVHLS-------DRSSPK 501
            :||.::..:..     |..|..:.:|      ||:.::    .:|..|:|.:       ....|:
Human   261 IPPAQLFQLQARSAALARHGPAVADL------LLQAYQ----FHAASPLHYAKFFDVNGSAFLPR 315

  Fly   502 NY 503
            ||
Human   316 NY 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 None
BTBD17XP_011523093.1 BTB 54..159 CDD:279045 22/116 (19%)
BTB 65..163 CDD:197585 19/109 (17%)
BACK 170..268 CDD:197943 27/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.