DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: axed and CG11714

Sequence 1:NP_001356975.1 Gene:axed FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001027123.1 Gene:CG11714 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster

Alignment Length:362 Identity:65/363 (18%)
Similarity:120/363 (33%) Gaps:126/363 (35%)


  Fly   123 PAPSAPPAHMMPPAYARGQTNIYTGVPIIVNPYIDFIVVNGDD----------RYMIRCERK--- 174
            |..:.|.:.|.......|:||.:|....|:.          |:          :.:..|...   
  Fly     5 PIRTLPNSKMRSCMMELGRTNRHTDCTFIIE----------DESGGSQSFPCHKLLFSCASDVFD 59

  Fly   175 -----SVLERSVELAKLIHAGPNSGRKSDNH---FQILNVDKNDFELIVRYME---KHFIPYR-- 226
                 ..:|.:..:.:|....|:...|..::   ::...:.|.||:.::|..|   |:.:...  
  Fly    60 RMLYGDYIESTSGVVRLNDVQPDIFEKFRDYVYGYECDKLQKYDFDTLIRLCEFANKYLVQSLEE 124

  Fly   227 -------------DHKHLLKILELSDRFNVPDLI-------------------IY---C------ 250
                         |...||::.:.:.|.|...||                   :|   |      
  Fly   125 DCVKDLLIRKNTFDMGELLRLFQCAHRMNRKSLINQIAWELKCTFKSTLDHSGVYEFNCEVFKHY 189

  Fly   251 IRELDLRISSATALDIFKALWFYQGIALTNQHQTVITTQETGQQLARKKATKAKAAAKQLAAAKA 315
            |..:..:||.|....:.:....|.|          |...|:..|:..:.||:|..         .
  Fly   190 IEVIASKISEADRFRLLEMYLKYNG----------IEELESAGQVDSQDATEANT---------T 235

  Fly   316 SQSTENGAEGDGAQQNLIPNPN--PFTTE-DYGV-----ALLHNTLQLIDMHAELQLSMPEISD- 371
            :.:|.|..|.   |::.:|:.:  |..|| .:.|     :.:.:.|.|||..   :||..|..| 
  Fly   236 TITTTNEVEN---QESELPSTSCVPLKTECSFAVPNKKASFVSDLLALIDFG---KLSPKEFYDG 294

  Fly   372 ----------LRFEELETLVK-----RDTLQLRSEVT 393
                      .::|.:..:.|     :|.|||:..:|
  Fly   295 PGKSNFLSLAEKYEHMYQIAKNCVTAKDELQLKMALT 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 None
CG11714NP_001027123.1 BTB 27..131 CDD:279045 14/114 (12%)
BTB 29..133 CDD:197585 13/114 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2075
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45774
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.