DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: axed and Btbd1

Sequence 1:NP_001356975.1 Gene:axed FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001011932.1 Gene:Btbd1 RGDID:1310962 Length:488 Species:Rattus norvegicus

Alignment Length:221 Identity:56/222 (25%)
Similarity:81/222 (36%) Gaps:57/222 (26%)


  Fly   283 QTVITTQETGQQLARKKATKAKAA------AKQLAAAKASQSTENGAEGDGAQQNLIPNPNPFTT 341
            :||:||..|    |:|.|..|..|      .|.|.|..|....        .|..|...|.    
  Rat   152 ETVMTTLYT----AKKYAVPALEAHCVDFLTKHLRADNAFMLL--------TQARLFDEPQ---- 200

  Fly   342 EDYGVALLHNTLQLIDMHAELQLSMPEISDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAEC 406
                  |....|..||......:|....:|:..:.|..:::||||.:| |..||..:..|:.|||
  Rat   201 ------LASLCLDTIDKSTVDAISAEGFTDIDIDTLCAVLERDTLSIR-ESRLFGAIVRWAEAEC 258

  Fly   407 ARKHIDATPENRRTVLGPLCLTPRYLRMTASEFRRCCERLELLPPTEISLITDALDGKKLKNLTD 471
            .|:.:..|..|::.|||......|:..||..||        ...|.:..:::|            
  Rat   259 QRQQLPVTFGNKQKVLGKALSLIRFPLMTIEEF--------AAGPAQSGILSD------------ 303

  Fly   472 QQAELLEKF------RQPRAEYARMP 491
              .|::..|      .:||.||...|
  Rat   304 --REVVNLFLHFTVNPKPRVEYIDRP 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 None
Btbd1NP_001011932.1 BTB 68..177 CDD:279045 10/29 (34%)
BTB 94..181 CDD:197585 11/33 (33%)
BACK 193..292 CDD:197943 32/118 (27%)
PHR 340..486 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.