DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axed and Btbd3

DIOPT Version :9

Sequence 1:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_663509.2 Gene:Btbd3 / 228662 MGIID:2385155 Length:530 Species:Mus musculus


Alignment Length:284 Identity:68/284 - (23%)
Similarity:109/284 - (38%) Gaps:77/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 ERKSVLERSVELAKLIH--AGPNSG-RKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLK 233
            ||.:|:..: :|...:|  .||..| ::...|..:|.|..:.|         |.:.|.:      
Mouse   116 ERNAVMFNN-DLMADVHFVVGPPGGTQRLPGHKYVLAVGSSVF---------HAMFYGE------ 164

  Fly   234 ILELSDRFNVPDL----------IIYCIRELDLRISSATALDIFKALWFYQGIALTNQHQTVITT 288
            :.|..|...:||:          .||| .|:||      |.|                  ||:.|
Mouse   165 LAEDKDEIRIPDVEPAAFLAMLKYIYC-DEIDL------AAD------------------TVLAT 204

  Fly   289 QETGQQLARKKATKAKAAAKQLAAAKASQSTENGAEGDGAQQN---LIPNPNPFTTEDYGVALLH 350
                           ..|||:......:::..|..|...:.:|   |:.....|...|    |..
Mouse   205 ---------------LYAAKKYIVPHLARACVNFLETSLSAKNACVLLSQSCLFEEPD----LTQ 250

  Fly   351 NTLQLIDMHAELQLSMPEISDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAECARKHIDATP 415
            ...::||..|||.|......|:.|:.||::::|:||..: |:.:||....|:..||.|:.:..:.
Mouse   251 RCWEVIDAQAELALKSEGFCDIDFQTLESILRRETLNAK-EIVVFEAALNWAEVECQRQDLALSI 314

  Fly   416 ENRRTVLGPLCLTPRYLRMTASEF 439
            ||:|.|||......|...|...:|
Mouse   315 ENKRKVLGKALYLIRIPTMALDDF 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 BTB <192..258 CDD:197585 17/76 (22%)
BACK <354..423 CDD:355779 24/68 (35%)
Btbd3NP_663509.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..48
BTB 121..224 CDD:279045 30/158 (19%)
BTB 129..228 CDD:197585 30/153 (20%)
BACK 234..340 CDD:197943 33/110 (30%)
PHR 385..528 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45774
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.