DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axed and W07A12.4

DIOPT Version :9

Sequence 1:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001343736.1 Gene:W07A12.4 / 174454 WormBaseID:WBGene00012322 Length:528 Species:Caenorhabditis elegans


Alignment Length:401 Identity:88/401 - (21%)
Similarity:131/401 - (32%) Gaps:150/401 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 GDDRYMIRCE-------------RKSVLERSVELAKLIHAGPNSGRKSDNHF-----QILNVDKN 209
            ||||..: |:             ...|.|.|....:||.:      ||.:.|     |..|.||.
 Worm   106 GDDRETL-CDMAKFYNNAQFSDVNMKVGEESYPAHRLILS------KSSDVFDRMMSQKWNGDKF 163

  Fly   210 DFELI------------VRYM-EKHFIPYRDHKHLLKILELSDRFNVPDLIIYCIRELDLRISSA 261
            |.||:            :|:| ..|.:.::|  :.|.:|.|:|::||..|...|:......|...
 Worm   164 DLELVEDELCQKAFAPFLRFMYSNHVVLHKD--NCLPLLVLADKYNVTTLKKVCLDFAQSEILPV 226

  Fly   262 TALDIFKALWFYQGIALTNQHQTVITTQETGQQLARKKATKAKAAAKQLAAAKASQSTENGAEGD 326
            ..|....::||                         ..||||                       
 Worm   227 IDLKELFSVWF-------------------------SYATKA----------------------- 243

  Fly   327 GAQQNLIPNPNPFTTEDYGVALLHNTLQLIDMHAELQLS---MPEISDLRFEELETLVKRDTLQL 388
                             |..:|:.:.:|.|.:..|..|:   ..:..:|..:::..::|.:.|::
 Worm   244 -----------------YHPSLIKSCMQAIALEFETLLTEEWEKDWQELHRDQMIEILKCNNLKV 291

  Fly   389 RSEVTLFECLATWSLAECARKHIDATPENRRTVLGPLC--LTP--RYLRMTASEFRRCCERLELL 449
            .||..|:|.|..|..|.   .|    .|.|....|||.  |.|  |:..|...|          |
 Worm   292 ASEFKLWEALQKWIQAP---NH----SERRGNTAGPLLAFLLPLIRFPFMNGDE----------L 339

  Fly   450 PPTEISLITDALDGKKLKNLTDQQAELLEKFRQP--RAEYARMPVHLSDRSSPKNYPKKMRLAHE 512
            ...|.|.|                :|:..|..||  ...|....:.||.|.|.|::.||..|.  
 Worm   340 NEVEKSAI----------------SEMHPKLFQPPLLLSYKFNALPLSSRMSCKDFTKKQFLL-- 386

  Fly   513 GRPTEDGCWEK 523
             |..||..|.:
 Worm   387 -RQYEDNRWNQ 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 BTB <192..258 CDD:197585 22/83 (27%)
BACK <354..423 CDD:355779 17/71 (24%)
W07A12.4NP_001343736.1 BTB_POZ_BTBD17 108..219 CDD:349601 30/119 (25%)
BACK 236..342 CDD:197943 34/187 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.