DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: axed and CG43120

Sequence 1:NP_001356975.1 Gene:axed FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001246754.1 Gene:CG43120 FlyBaseID:FBgn0262580 Length:286 Species:Drosophila melanogaster

Alignment Length:99 Identity:19/100 (19%)
Similarity:37/100 (37%) Gaps:34/100 (34%)


  Fly   149 PIIVNPYIDFIVVNGDDRY----------MIRCERK----SVLERSVELAKLIHAGPNSGRKSDN 199
            |.:...::|||....||::          :::|...    .:.||.:::  |:...|        
  Fly    63 PEVFQIFLDFIYAPNDDQFGNLEPDVLMCLLKCANMWLAVEIEERCIDI--LLDLSP-------- 117

  Fly   200 HFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLK 233
                   |.:...||..:...|.:   |||.|::
  Fly   118 -------DMDPDALIALFAVSHCV---DHKVLME 141

Known Domains:


GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 None
CG43120NP_001246754.1 BTB 12..113 CDD:279045 10/52 (19%)
BTB 21..116 CDD:197585 10/55 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2075
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.