DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axed and CG43120

DIOPT Version :10

Sequence 1:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001246754.1 Gene:CG43120 / 12798252 FlyBaseID:FBgn0262580 Length:286 Species:Drosophila melanogaster


Alignment Length:99 Identity:19/99 - (19%)
Similarity:37/99 - (37%) Gaps:34/99 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 PIIVNPYIDFIVVNGDDRY----------MIRCERK----SVLERSVELAKLIHAGPNSGRKSDN 199
            |.:...::|||....||::          :::|...    .:.||.:::  |:...|        
  Fly    63 PEVFQIFLDFIYAPNDDQFGNLEPDVLMCLLKCANMWLAVEIEERCIDI--LLDLSP-------- 117

  Fly   200 HFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLK 233
                   |.:...||..:...|.:   |||.|::
  Fly   118 -------DMDPDALIALFAVSHCV---DHKVLME 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 BACK <354..423 CDD:475122
CG43120NP_001246754.1 BTB_POZ_ZBTB_KLHL-like 19..99 CDD:349497 7/35 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.