DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: axed and Btbd19

Sequence 1:NP_001356975.1 Gene:axed FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_008762294.1 Gene:Btbd19 RGDID:2320529 Length:395 Species:Rattus norvegicus

Alignment Length:178 Identity:35/179 (20%)
Similarity:63/179 (35%) Gaps:67/179 (37%)


  Fly   134 PPAYARGQTNIYTGV--PIIVNP-YIDFIVVNGDDRYMI---------RC---ER---------- 173
            |....|||...::..  .:|.|| |.|...|.|.:|..:         ||   :|          
  Rat     4 PGLVVRGQAAPFSTALRSLINNPRYSDICFVVGQERQEVFAHRCLLACRCNFFQRLLGPGIPSPV 68

  Fly   174 ----------KSVLE----RSVELAKLIHAGPN---SGRKSDN-------HFQILNVDKNDFELI 214
                      .:|||    .||:|.:...:.|:   .||::::       .|..||...:     
  Rat    69 VLSTVPAEAFLAVLEFLYTNSVKLHRYSVSLPSRGLGGREAEDARGAGETPFCSLNHSHS----- 128

  Fly   215 VRYMEKHFIPYRDHKHLLKILELSDRFNVPDLIIYC----IRELDLRI 258
                     |:.|...:|::|..:..:.:.:|...|    ::.||:.:
  Rat   129 ---------PHPDPVQVLEVLTAAVEYGLEELRELCLEFVVKVLDVEL 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 None
Btbd19XP_008762294.1 BTB 19..>90 CDD:279045 15/71 (21%)
BTB 30..>97 CDD:197585 13/67 (19%)
BACK 172..>237 CDD:197943
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2355092
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.