DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: axed and btbd1

Sequence 1:NP_001356975.1 Gene:axed FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_017947438.1 Gene:btbd1 XenbaseID:XB-GENE-969035 Length:480 Species:Xenopus tropicalis

Alignment Length:247 Identity:59/248 (24%)
Similarity:88/248 (35%) Gaps:79/248 (32%)


  Fly   261 ATALDIFKALWFYQGIALTNQH---------------------------QTVITTQETGQQLARK 298
            ||...:|.|: |..|:|.|:..                           :||:||..|    |:|
 Frog    96 ATGSAVFDAM-FNGGMATTSTEIELPDVEPAAFLALLRFLYSDEVQIGPETVMTTLYT----AKK 155

  Fly   299 KATKAKAA------AKQLAAAKASQSTENGAEGDGA-----QQNLIPNPNPFTTEDYGVALLHNT 352
            .|..|..|      .|.|.|             |.|     |..|...|.          |....
 Frog   156 YAVPALEAHCVDFLTKHLRA-------------DNAFLLLTQARLFDEPQ----------LASLC 197

  Fly   353 LQLIDMHAELQLSMPEISDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAECARKHIDATPEN 417
            |..||.:....::....:|:....|..:::||||.:| |..||.....|:.|||.|:.:..:.||
 Frog   198 LDTIDKNTVDAINAEGFTDIDINTLCAVLQRDTLSIR-ESHLFGAAVRWAEAECQRQQLPVSTEN 261

  Fly   418 RRTVLGPLCLTPRYLRMTASEFRRCCERLELLPPTEISLITDALDGKKLKNL 469
            :..|||......|:..||..||        ...|.:..:::|    :::.||
 Frog   262 KMKVLGKALPLIRFPLMTVEEF--------AAGPAQSGILSD----REVVNL 301



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.