DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: axed and btbd6a

Sequence 1:NP_001356975.1 Gene:axed FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001108397.1 Gene:btbd6a ZFINID:ZDB-GENE-080218-26 Length:525 Species:Danio rerio

Alignment Length:470 Identity:97/471 (21%)
Similarity:150/471 (32%) Gaps:200/471 (42%)


  Fly    44 LEEHLVKEKRITKFPLVGAL------VHKALRRREEAE------------DEKVQITGPEDNQH- 89
            |.|.|.|.||.:|.|  |.|      :..:|::|..||            ...|.::.||..:: 
Zfish    10 LPETLKKLKRASKHP--GRLSVCYNILTLSLKKRMAAELYPVSDHATLQKSGAVMLSLPEKKRNV 72

  Fly    90 ----------------QQNNNNND-----W--------EPNRMV--------LPFGLGPDGHHVD 117
                            :||.|||:     |        |.|.::        :.|.:||.|.   
Zfish    73 EPVSQTTASIATTPTTEQNINNNNVEIPSWHSAHPTLRERNALMFNNEQMADVHFIVGPPGE--- 134

  Fly   118 AIQSAPAPSAPPAHMMPPAYARGQTNIYTGVPIIVNPYIDFIVVNGDDRYMIRCERKSVLERSVE 182
                   ....|||.            |.   :.|...:...:..||                  
Zfish   135 -------SQRVPAHK------------YV---LAVGSSVFCAMFYGD------------------ 159

  Fly   183 LAKLIHAGPNSGRKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLKILELSDRFNVPDLI 247
            ||           :.|:...|.:|:...|.::::||      |.|.      :||:     ||  
Zfish   160 LA-----------EGDSDIHIPDVEPAAFLILLKYM------YSDE------IELA-----PD-- 194

  Fly   248 IYCIRELDLRISSATALDIFKALWFYQGIALTNQHQTVITTQETGQQLARKKATKAKAAAKQLAA 312
                                                ||:.|              ..||.|.|.:
Zfish   195 ------------------------------------TVLAT--------------LYAAKKYLVS 209

  Fly   313 AKASQST---ENGAEGDGA-----QQNLIPNPNPFTTEDYGVALLHNTLQLIDMHAELQLSMPEI 369
            |.|....   |...|...|     |..|...|.          |.....::||..|||.|.....
Zfish   210 ALARACVGFLETSLEARNACVLLSQSRLFEEPE----------LTQRCWEVIDAQAELALRSEGF 264

  Fly   370 SDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAECARKHIDATPENRRTVLGPLCLTPRYLRM 434
            |::....||:::.|:||.::..| :|:.:..|:.|||.|:.:..|.:|:|:|||......|...|
Zfish   265 SEIDLPTLESILHRETLNVKESV-VFQAVLGWADAECRRQGLSPTSQNQRSVLGKALHLVRLPSM 328

  Fly   435 TASEFRRCCERLELL 449
            |..||.....::::|
Zfish   329 TLQEFADGAAQVDIL 343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 None
btbd6aNP_001108397.1 BTB 116..219 CDD:279045 34/226 (15%)
BTB 124..223 CDD:197585 35/222 (16%)
BACK 229..335 CDD:197943 34/117 (29%)
PHR 380..523 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45774
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.