DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: axed and btbd2

Sequence 1:NP_001356975.1 Gene:axed FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_002937976.1 Gene:btbd2 XenbaseID:XB-GENE-491865 Length:545 Species:Xenopus tropicalis

Alignment Length:416 Identity:95/417 (23%)
Similarity:140/417 (34%) Gaps:136/417 (33%)


  Fly   108 GLGPDGHHVDAIQSAPA---PSAPPAHMMPPAYARGQTNIYTGVPIIVNPYIDFIVVNGDDRYMI 169
            |....|:...|..||..   |:|||.  .|||.|       ....::..|.           |..
 Frog    72 GASSPGNQAAAAVSASGVSPPAAPPP--PPPAAA-------AAAGLLREPV-----------YNW 116

  Fly   170 RCERKSVLERSVELAKLIHAGPNSGRKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLKI 234
            :..:.:|.||...|.       |:...||.||           |:.:.:....||  .|:.:|.:
 Frog   117 QATKTTVRERFTFLF-------NNEVLSDVHF-----------LVGKGLGSQRIP--AHRFVLAV 161

  Fly   235 -------------LELSDRFNVPDLIIYCIRELDLRISSATALDIFKALWFYQGIALTNQHQ--- 283
                         ...|....:||            :..|..|.:.|.|:       :::.|   
 Frog   162 GSAVFDAMFNGGMATTSTEIELPD------------VEPAAFLALLKFLY-------SDEVQIGP 207

  Fly   284 -TVITTQETGQQLARKKATKAKAA------AKQLAAAKASQSTENGAEGDGAQQNLIPNPNPFTT 341
             ||:||..|    |:|.|..|..|      .|.|.|..|....        .|..|...|.    
 Frog   208 ETVMTTLYT----AKKYAVPALEAHCVEFLKKNLRADNAFMLL--------TQARLFDEPQ---- 256

  Fly   342 EDYGVALLHNTLQLIDMHAELQLSMPEISDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAEC 406
                  |....|:.||.:....|:....:|:..:.|..:::||||.:| |:.||..:..||.|||
 Frog   257 ------LASLCLENIDKNTSDALNAEGFTDIDLDTLVAVLERDTLGIR-EIRLFNAVVRWSEAEC 314

  Fly   407 ARKHIDATPENRRTVLGPLCLTPRYLRMTASEFRRCCERLELLPPTEISLITDALDGKKLKNLTD 471
            .|:....|.||:|..||......|:..||..||        ...|.:..::||            
 Frog   315 QRQQHPVTSENKRKSLGKALSLIRFPLMTIEEF--------AAGPAQSGILTD------------ 359

  Fly   472 QQAELLEKF------RQPRAEYARMP 491
              .|::..|      .:||.|:...|
 Frog   360 --REVVSLFLHFTVNPKPRVEFIDRP 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 None
btbd2XP_002937976.1 BTB 130..234 CDD:279045 29/147 (20%)
BTB 138..237 CDD:197585 27/135 (20%)
BACK 249..348 CDD:197943 34/118 (29%)
PHR 396..543 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.