DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: axed and btbd3

Sequence 1:NP_001356975.1 Gene:axed FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001090697.1 Gene:btbd3 XenbaseID:XB-GENE-975947 Length:518 Species:Xenopus tropicalis

Alignment Length:392 Identity:86/393 (22%)
Similarity:137/393 (35%) Gaps:141/393 (36%)


  Fly    69 RRREEAE---DEKVQITGPEDNQ--HQQNNNNNDWEPNRMVLPFGLGPDGHHVDAIQSAPAPSAP 128
            :::..||   ::|.....|...|  ||||.|||:                       :.|:|   
 Frog    55 KKKMAAEIFPNKKPANNNPNSIQQYHQQNLNNNN-----------------------TIPSP--- 93

  Fly   129 PAHMMPPAYARGQTNIYTGVPIIVNPYIDFIVVNGDDRYMIRCERKSVLERSVELAKLIH--AGP 191
                    :.||   :|..:.                      ||.:|:..: :|...||  .||
 Frog    94 --------HWRG---LYATIR----------------------ERNAVMFNN-DLMADIHFVVGP 124

  Fly   192 NSG-RKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLKILELSDRFNVPDL--------- 246
            ..| ::...|..:|.|..:.|         |.:.|.:      :.|.:|...:||:         
 Frog   125 PGGTQRIPGHKYVLAVGSSVF---------HAMFYGE------LAEDNDEIRIPDVEPAAFLAML 174

  Fly   247 -IIYCIRELDLRISSATALDIFKALWFYQGIALTNQHQTVITTQETGQQLARKKATKAKAAAKQL 310
             .:|| .|:||      |.|                  ||:.|               ..|||:.
 Frog   175 KYMYC-DEIDL------AAD------------------TVLAT---------------LYAAKKY 199

  Fly   311 AAAKASQSTENGAEGDGAQQN---LIPNPNPFTTEDYGVALLHNTLQLIDMHAELQLSMPEISDL 372
            .....:::..|..|...:.:|   |:.....|...|    |.....::|:..|||.|......|:
 Frog   200 IVPHLARACVNFLETSLSAKNACVLLSQSCLFEEPD----LTQRCWEVIEAQAELALKSEGFCDI 260

  Fly   373 RFEELETLVKRDTLQLRSEVTLFECLATWSLAECARKHIDATPENRRTVLGPLCLTPRYLRMTAS 437
            .|:..|:::.|:||..: |:.:||....|:.|||.|:.:..|.||:|.|||......|...|...
 Frog   261 DFQTFESILNRETLNAK-EIVVFEAALNWAEAECHRQELPPTIENKRKVLGKALYLIRIPTMALD 324

  Fly   438 EF 439
            ||
 Frog   325 EF 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 None
btbd3NP_001090697.1 BTB 109..212 CDD:279045 30/159 (19%)
BTB 117..216 CDD:197585 30/154 (19%)
BACK 222..328 CDD:197943 34/111 (31%)
PHR 373..516 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.