DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13300 and CG42747

Sequence 1:NP_648043.1 Gene:CG13300 FlyBaseID:FBgn0035699 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_648045.2 Gene:CG42747 FlyBaseID:FBgn0261801 Length:404 Species:Drosophila melanogaster

Alignment Length:384 Identity:126/385 (33%)
Similarity:175/385 (45%) Gaps:99/385 (26%)


  Fly    19 VNQVASVSVSISASASALPSVSA------SEFPTFSPPRIASLVASSSAEDLSSFGDVTFDIFDD 77
            :.|.||.::......|.|.|::.      |:.|  .||...::..:||         :.::..:|
  Fly     4 IYQDASTTLRSVFPNSRLDSLAGVDRRMESQLP--GPPDADAVTTASS---------IGYNPLND 57

  Fly    78 DD--------DLFGSPMAFDASEQGLWNGRFVPPPPRPPFFVDEPVLSDGLTTCDLCSWAMPTKS 134
            ||        |.|.||:||||||.|||||.||||||||| |:||.|.:|||||||||:||. .::
  Fly    58 DDWWANAIEVDTFDSPLAFDASENGLWNGHFVPPPPRPP-FLDESVAADGLTTCDLCTWAW-QRN 120

  Fly   135 TFMFEGTIEKATELGWPLTLIIVSVLSALLGAIIMIAVVRCRRKKSSNNRNDTHVQWWSRNKRAH 199
            .:..:|:||.|.||||..||||||::|||:|||:|:.|:||||.||:|........||.||.|  
  Fly   121 AYSLDGSIETAGELGWAFTLIIVSIISALIGAIVMVIVLRCRRIKSANANGGRPQPWWCRNNR-- 183

  Fly   200 GNGLNGAGGASGAAGGAGGNVHHHNGSSSNINNNHLRRSNIYTAHPADSIRGLQPLPVVLPLPLS 264
                                    ||..:        ||.|...|.|||||              
  Fly   184 ------------------------NGGQN--------RSPISIKHSADSIR-------------- 202

  Fly   265 LPHPPSG-----GASPASSS--------TTPPATQQQQH-----QPLQQQQYFHPYQQQQHVHHS 311
            .|...||     |.|..||:        :|.||.....|     .|:...:..:....::.|..:
  Fly   203 RPTSNSGVWTWLGGSRRSSAGPDQIGPPSTSPAENHYTHMDDAYSPVGVSEALYAELDRESVRSA 267

  Fly   312 HTHHHHTHHHVPLYPHDCDEDAAYEEPEYHQPQQLHSVNSSSSLSSMGSSSLPQEASNS 370
            :..:.:|.:      ..|.|...|:..|...|..:.|..||:..|.:..:::|..||.|
  Fly   268 NPSYQNTAY------SQCGEKYNYQGHEQDIPMVVSSAPSSAYYSDLSVTAMPGGASGS 320



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCMD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.