DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tnpo and imb-2

Sequence 1:NP_001261472.1 Gene:Tnpo FlyBaseID:FBgn0024921 Length:893 Species:Drosophila melanogaster
Sequence 2:NP_001309574.1 Gene:imb-2 WormBaseID:WBGene00002076 Length:889 Species:Caenorhabditis elegans

Alignment Length:906 Identity:449/907 (50%)
Similarity:621/907 (68%) Gaps:30/907 (3%)


  Fly     1 MTWEPQGEGLQQIIAILKESQSPDTATQMAVQMKLEEFNRYPDFNNYLIYVLTKLKTE-DEPTRS 64
            |.::|....|:|:|.:|:.:.|.|...|..||::|.:.|.:..|..||:|:|:.:|.. |..:||
 Worm     1 MAFQPDQHELEQVIQLLQHAHSTDRDVQRNVQVQLVQLNEHQKFCCYLVYILSDMKEMIDATSRS 65

  Fly    65 LSGLILKNNIRMHGTTLQPEIVEYIKHECLQAVGDASPLIRATVGILITTIASNGGLHNWPQLLP 129
            |:||:||||||........::..:::..||:::||..|||||||||::|||.....:.:||.||.
 Worm    66 LAGLLLKNNIRAKWNKYPQDVKFFVRTTCLKSIGDQEPLIRATVGIIVTTIVMEENMCDWPDLLD 130

  Fly   130 SLCEMLDNQDYNVCEGAFSALQKICEDSAEILDSAALNRPLNIMIPKFLEYFKHSSPKIRSHAIA 194
            :|..:|...|..:.|||..||||:.||||:..:|..| ||:   :||.|.:::|.:.|:|:.|:.
 Worm   131 TLATVLMQPDELMQEGALGALQKVFEDSADRYESEFL-RPI---MPKLLVFYEHHAAKMRALAMN 191

  Fly   195 CINQFIINRSQALMLNIDSFIENLFHLSSDEDHEVRKNVCHGLVMLLEVRMDRLMPHMSQIIEYM 259
            |:|..::..:..:...||.|:.:||...:|.|.||:|.:|..|.:||:..::::|||:..:|||:
 Worm   192 CVNCILMVNNDPIDFAIDQFLTSLFARHNDNDEEVQKQLCRSLTLLLDTHIEKMMPHLPNVIEYI 256

  Fly   260 LLRTQDTDEGVALEASEFWLSLAEQS-ICKDVLAPYLAQLAPVLVRGMRYSEVDIILLKGNVEED 323
            :.:|||.:|.:||||.|||||:||.| ||:.::.|:|.:|.|||:..|||||.| ..||.| :||
 Worm   257 IKKTQDHNESIALEACEFWLSIAENSDICRTMVLPHLDKLIPVLLGSMRYSETD-PALKAN-DED 319

  Fly   324 DMVPDREEDIRPRFHKSRAHTIRSTQEGGAGATGDDDDDEFEDGMDDDSSLSEWNLRKCSAAALD 388
            ..||||||||:||||||:.|        |.|...:.||:|.||  |||....:||:|:||||:||
 Worm   320 SSVPDREEDIKPRFHKSKQH--------GLGGLVESDDEEDED--DDDDGGGDWNIRRCSAASLD 374

  Fly   389 VLANVFREDCLPVVLPILKETLFHQEWVIKESGVLALGAIAEGCMQGMIQHLPELIPYLISCLSD 453
            |||::|.:|.|..:.|:||:||.:..|::||||:|||||||||||.|::.||.||||::::.:.|
 Worm   375 VLASIFGKDLLDKLFPLLKDTLMNDNWLVKESGILALGAIAEGCMDGVVPHLGELIPFMLAMMFD 439

  Fly   454 KKALVRSITCWTLSRYANWVVNQPH--DQYLKPLMEELLKRILDSNKRVQEAACSAFATLEEEAC 516
            ||.|||||||||||||::.:.:..:  .|:.|.::..||:..||.||:||||||||||||||||.
 Worm   440 KKPLVRSITCWTLSRYSSHIASDENFRQQFFKDVLANLLRCSLDGNKKVQEAACSAFATLEEEAG 504

  Fly   517 TELVPYLEYILKTLVFAFSKYQHKNLLILYDAVGTLADSVGHHLNKPQYIDILMPPLIDKWNLLK 581
            .:|:|:|..||..||.||..||.|||||||||:||||:|||..|:.|.|:.:|||||::||..|.
 Worm   505 EQLIPFLGEILDQLVKAFQCYQAKNLLILYDAIGTLANSVGDALSHPVYVQMLMPPLMEKWERLS 569

  Fly   582 DDDKDLFPLLECLSSIATALQSGFLPYCDPVYRRCISLIEQTI--NQEMLCKQNQTYDHPDKERM 644
            |:||:|||||||:|:|.:|:...||||..||:.||.||||:.:  ||:.:...:|. :.|:.:.:
 Worm   570 DEDKELFPLLECISAIVSAMGQSFLPYIQPVFTRCCSLIEKCVQQNQQHIMAPDQV-EAPETDFI 633

  Fly   645 IVALDLLSGLAEGLDRHIETLVANSNIMHLLYQCMQDVLPEVRQSSFALLGDLTKACFPHVHP-- 707
            ||||||||||||.|..|::.|||||.::.|:..|..||.|:||||.|||||||||||...|.|  
 Worm   634 IVALDLLSGLAESLPEHMDPLVANSKLVELMLFCSLDVTPDVRQSCFALLGDLTKACPERVLPQS 698

  Fly   708 ----FMADFFPILGQNLNPDFISVCNNATWAIGEICMKLGEETKQYIRLVLSDLFIIIN-RPNTP 767
                |..:|...|.|||:|..|||||||.||:||:.:|:|...||:|..::..|.::|| :.|..
 Worm   699 KILQFAGNFIFFLAQNLDPSKISVCNNAIWALGELALKMGPAMKQFIGPIIEPLIVVINSQQNMQ 763

  Fly   768 KTLLENTAITIGRLGYVCPVEVAPYLPEFVRQWCTSLRHIRDNDEKDSAFRGMCHMITVNPAGVV 832
            :||||||||||||||..|..|:||::..|||..|.|||:|:||.||:|||.|:|:||.:||.||:
 Worm   764 RTLLENTAITIGRLGQCCGEELAPHISRFVRPCCYSLRNIKDNAEKESAFIGLCNMINMNPVGVL 828

  Fly   833 ADFIFFCDAIASWVNPPEDLHQMIQKILHGFKTQVGEENWRRFVEQFPPTLAERLTTMYNI 893
            .||||:|||||||..|.:.|..:...||..||.|||:.||..|:.|.||.|.|||:..|.|
 Worm   829 NDFIFWCDAIASWTVPTDSLRVLFAGILQSFKQQVGDFNWNNFILQLPPPLRERLSAFYQI 889

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TnpoNP_001261472.1 IBN_N 32..99 CDD:281761 24/68 (35%)
ARM 127..234 CDD:237987 39/107 (36%)
HEAT repeat 127..155 CDD:293787 12/28 (43%)
HEAT repeat 172..202 CDD:293787 9/30 (30%)
HEAT repeat 213..239 CDD:293787 10/26 (38%)
HEAT repeat 252..281 CDD:293787 16/29 (55%)
HEAT_2 399..507 CDD:290374 60/110 (55%)
HEAT repeat 402..430 CDD:293787 17/28 (61%)
HEAT_EZ 415..469 CDD:290247 38/54 (70%)
HEAT repeat 442..472 CDD:293787 20/30 (67%)
HEAT repeat 481..510 CDD:293787 17/29 (59%)
HEAT repeat 670..702 CDD:293787 20/32 (63%)
HEAT repeat 711..737 CDD:293787 16/26 (62%)
imb-2NP_001309574.1 KAP95 15..764 CDD:227540 371/766 (48%)
IBN_N 32..100 CDD:281761 24/68 (35%)
HEAT repeat 128..156 CDD:293787 12/28 (43%)
HEAT repeat 169..201 CDD:293787 10/35 (29%)
HEAT repeat 210..236 CDD:293787 10/26 (38%)
HEAT repeat 249..278 CDD:293787 16/29 (55%)
HEAT repeat 388..416 CDD:293787 17/28 (61%)
HEAT_EZ 401..455 CDD:290247 38/54 (70%)
HEAT repeat 428..458 CDD:293787 20/30 (67%)
HEAT repeat 467..498 CDD:293787 18/31 (58%)
HEAT repeat 512..539 CDD:293787 18/27 (67%)
HEAT repeat 554..585 CDD:293787 19/31 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2023
Hieranoid 1 1.000
Homologene 1 1.000 H5358
Inparanoid 1 1.050 864 1.000 Inparanoid score I212
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D525700at2759
OrthoFinder 1 1.000 FOG0001211
OrthoInspector 1 1.000 T374774
orthoMCL 1 0.900 OOG5_127643
Panther 1 1.100 LDO PTHR10527
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R601
TreeFam 1 0.960
1312.870

Return to query results.
Submit another query.