DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7376 and Shprh

Sequence 1:NP_001261471.1 Gene:CG7376 FlyBaseID:FBgn0035689 Length:1270 Species:Drosophila melanogaster
Sequence 2:NP_001071175.1 Gene:Shprh MGIID:1917581 Length:1674 Species:Mus musculus

Alignment Length:1695 Identity:429/1696 (25%)
Similarity:687/1696 (41%) Gaps:506/1696 (30%)


  Fly     7 CEIADEVPPES------------------PEDPTE-----------FRYGKKRWVF--------- 33
            |.|.||.||||                  .|:.|.           :|.......|         
Mouse    52 CIIIDEGPPESALHRDKKRRSETVSVLEATEEETRLSVTLNVTVSPYRVDNSWKAFLGDFALQLL 116

  Fly    34 -KDNLVEH-------------KEEILICI-EKCQNARTRK--------LKFRSIRQESGSCILVL 75
             |::||||             ..:.||.: .:|:|...::        :..:.||.||.....:|
Mouse   117 PKESLVEHFSERTFTLSPSESSSQFLIYVHSECKNVEKQENVLEGSAGVCSKGIRVESSFSSDML 181

  Fly    76 SHEQTHVRAREIEM----------EVGEQVLP-----LFFKDFRGSLEFEVAQQEKEHKRPLKTY 125
            .......:.|.|::          :||..:|.     |.|....||...:..|..|.....|..:
Mouse   182 QDLAWLQKRRGIKLYQRPDGTHTIKVGIYILEAGLTRLDFMSDAGSRMKKFNQLMKRVMEKLHNF 246

  Fly   126 VTTKL----------------YDALYEKHRQTVHVEQERSLDLPKRFQS---QLRKYQQRTVSWM 171
            :...:                .|.||...:|| |.::.||:.:..:..:   .||.||:..|:||
Mouse   247 IIPDVLEEEEEGSESEPEGQDIDELYHFVKQT-HQQETRSVQVDVQHPALIPVLRPYQREAVNWM 310

  Fly   172 LGREQQITQVPANFIVLHAI-------DGITRVFKHKY--CLQFYPFEEEIPKISLPPGGILADE 227
            |.:||..:..||: ..||.:       ||: :::.:.|  |: ...|....|::.   |||||||
Mouse   311 LQQEQFRSAPPAD-NSLHFLWREIVTPDGL-KLYYNPYTGCI-IRDFPHAGPQLL---GGILADE 369

  Fly   228 MGLGKTVEFLAMLLMNPR------------------------PQDSYRN----DYWHQRLEE--- 261
            ||||||||.||::|.:.|                        |::..:|    |..::..|:   
Mouse   370 MGLGKTVEVLALILTHTRQDVKQDALTLPEGKVVNYFIPTHCPREKVKNREIQDTEYEPKEKVHC 434

  Fly   262 --------------------------------FSDEVPLKRSRISK------------------- 275
                                            |..:|...|..:.:                   
Mouse   435 PPTRVMILTAVKEMNGKKGVSILSIYKYVSSIFRYDVQRNRGLLKRMLKCLIFEGLVKQIKGHGF 499

  Fly   276 ----------KDEVF-------------------------------------------------- 280
                      |::||                                                  
Mouse   500 SGTFTLGKNYKEDVFDKTKKQAVGSPRKIEKELRKSVNKDADSEYLPSNTSDDDEPYYYYCKAGK 564

  Fly   281 ----------------------------------------------------------------- 280
                                                                             
Mouse   565 SRSKLKKPALLTKKGKGQSVHLDSQGDAPAAGVCASTDVHVSENTCVSEDKQTQEAKDCAESPNP 629

  Fly   281 ----------------------CICTK----KHGKRVQCTKCRRWQHEMCMTISEKS--DLPHLC 317
                                  |||.:    .|..||||.||..|||..|:...||:  ..|..|
Mouse   630 AAEELAQSNTSSPCETSDYRFECICGEFDQIGHKPRVQCLKCHLWQHAKCVNYEEKNLKVKPFYC 694

  Fly   318 PSCWSELVKSGERLVESGATIIVSPNAIKMQWFEEIHKHI-SPSLKVLLYFGLHSTFWVSPFDLA 381
            |.|...:     ..|.:.||:|:||::|..||.:||::|: |.||:||:|.|:....::.|..||
Mouse   695 PHCLVAM-----EPVSTRATLIISPSSICHQWVDEINRHVRSSSLRVLVYQGVKKHGFLQPHFLA 754

  Fly   382 QYDVVLTDYTILRNEIYHT----TDFKSDRQMRHQQRYMRPNSPLLMVNWWRVCLDEAQMVESST 442
            :.|:|:..|.:||:|:.:.    ::.:..|::|:|:|||...|||:.|.|||:|||||||||..|
Mouse   755 EQDIVIITYDVLRSELNYVNIPHSNSEDGRRLRNQKRYMAIPSPLVAVEWWRICLDEAQMVECPT 819

  Fly   443 SAAAEMVRMLPAINRWAVTGT-----IDELPPLLEFVGRPEVCRPPDAWQTVDKAFQLNY----K 498
            ..||||.:.|..||||.::||     :::|..|:.|:|....|  ...|.     .:|.|    |
Mouse   820 VKAAEMAQRLSGINRWCISGTPVQRGLEDLFGLVVFLGIEPYC--VKHWW-----IRLLYHPYCK 877

  Fly   499 CEP--LLELLEHSLWRTCKSKVEHELGIPPQTEVVHRLELSNVESLYYREEHLKCHEQFLAAVAK 561
            ..|  |...:...:||:.|..|..::.||||||.:|.|..|.||..:|..:|..|.:.   |:.|
Mouse   878 KNPQHLYSFIAKIMWRSAKKDVIDQIQIPPQTEEMHWLHFSPVERHFYHRQHEVCCQD---AIVK 939

  Fly   562 HTRHNADNSSCLASISPQLLRIILKPFLRIRQTCSVPVVFNSNV----SSTDYLHPQDLLARLKS 622
             .|..:|.:..|:|:..:.:..||.|.||:||.|..|.......    .||  :..::||..|:.
Mouse   940 -LRKISDWALKLSSLDRRTVSSILYPLLRLRQACCHPQAVRGEFLPLQKST--MTMEELLTSLQK 1001

  Fly   623 NNENECKTELRTWASSYNGLAAIYFIKNDFPQAIKYYNLLLKLANEYNEQNISVDSVLQIHAIYN 687
            ....||:...|....:.||||.|:.||.::..|.:.|..:|: ::|.::..:..||:.::||.:|
Mouse  1002 KCGTECEEAHRQLVCALNGLAGIHIIKGEYALAAELYREVLR-SSEEHKGKLKTDSLQRLHATHN 1065

  Fly   688 LLQASSLAPAEHK--LTELEHKKYQAQMSRLEWKYLED-NTRVLES--ALSSYNENLEKVSELEK 747
            |::   |..|:|.  ...|...:.:.:..:|...|:.. ||.|.|:  ||....::   :.||::
Mouse  1066 LME---LLGAKHPGIPPTLRDGRLEEEAKQLREHYMSKCNTEVAEAQQALQPVQQS---IRELQR 1124

  Fly   748 RFEGST---LDLLATMVNHKT---SLHDAIWNKVRDDFFRQNISVERLENVNSMAGMLYFMDIWH 806
            :...::   |:::     |:.   |:.:.:..:||::     ||....:..:.::....|.|.  
Mouse  1125 KIHSNSPWWLNVI-----HRAMEFSVDEELVQRVRNE-----ISSNYKQQTDKLSMSEKFRDC-- 1177

  Fly   807 NKLQNLKSTLIAEFEFLKGVMQQACEAIKTGVLLSMEIINFIENVTVCHLTDILDANKDKPVKPK 871
            ..||.|.:|.:.|....:.::::|.:.::...  |.|:   ||:.|||||         :|.:..
Mouse  1178 RGLQFLLTTQMEELHKFQKLVREAVKKLEKPP--SREV---IESATVCHL---------RPARLP 1228

  Fly   872 KHRYCRLCLIRDSLNQFECLLFAKKL-------------------DEKATVTEGLENPSMEISFI 917
            .: .|..|...:...::|..||...:                   |...|.|.||...|.....:
Mouse  1229 LN-CCVFCKADELFTEYESKLFFNTVKGQTAIFEEMIEDEEGLVDDRVPTTTRGLWAVSETERSM 1292

  Fly   918 KSIFAFLRSKQDFSEWKEECQSKLELLSCLQDLVKFQIKYWIEVEYMVKAFDELEMCKMRILLTD 982
            |:|.:|.||.:...|:.:|....::|....:...|...:||:.:...|.|.|||.|...|:.:..
Mouse  1293 KAILSFARSHRFDVEYVDEGSVSMDLFEAWKKEYKLLHEYWMTLRNRVSAVDELAMATERLRVRH 1357

  Fly   983 DPEEQSN---YRILACQLDEQLQFNQYN---LQTSQLNFTRLCGRLKYLKHLKEDSADK------ 1035
            ..|.:.|   :.|:.....||.:....|   :.||||.  :..|:|.||.:| |.|.||      
Mouse  1358 PKEPKPNPPVHHIIEPHEVEQNRIKLVNDKAVATSQLQ--KKLGQLLYLTNL-EKSQDKTSGGIN 1419

  Fly  1036 --PCPICQTQDDVRYVMMVCGHFVCQHC----LDSMRRKNGRAGVTKCPLCRQDSPQLYYSVRPG 1094
              |||||..|...::.::.|||..|..|    ::.....:.|:.: ||.:|||.:          
Mouse  1420 PEPCPICARQLGKQWAVLTCGHCFCNECTSIIIEQYSVGSHRSSI-KCAICRQTT---------- 1473

  Fly  1095 AHKSII-----------------GDFSTKISSVVELVLKIKGENEQEKIIVFSQWQAILIEIARA 1142
            :||.:.                 |..|||:.:||..::||:..:...|.:|||.||.:|..|::|
Mouse  1474 SHKEVSYVFTSEKANQEDDIPVKGSHSTKVEAVVRTLMKIQLRDPGAKALVFSTWQDVLDIISKA 1538

  Fly  1143 LSLNGIQF----RNKCTNKDFDDFK-NPLSNVTCLLMPLSKGSKGLNLIEATHVFLVEPILNPGD 1202
            |:.|.::|    |.|...::...|| :|..|:  ||:||..||.||.:||||||.||||||||..
Mouse  1539 LTDNNMEFTQISRIKTFQENLSAFKYDPHINI--LLLPLHTGSNGLTIIEATHVLLVEPILNPAH 1601

  Fly  1203 ERQAIGRIHRFGQKRPTKVHRFIVNETIEENILSLITSADDTTTLST--HWDLENMTLDSLKKLF 1265
            |.|||||:||.||.:||.||||::..||||.:.:::.:|:.:.|.|:  |.:...:|:..|..||
Mouse  1602 ELQAIGRVHRIGQTKPTIVHRFLIKATIEERMQAMLKTAERSHTSSSGKHSEASVLTVAGLADLF 1666

  Fly  1266 ILKEE 1270
            ..:.|
Mouse  1667 TKENE 1671

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7376NP_001261471.1 SNF2_N 221..601 CDD:278600 155/631 (25%)
PHD_SF 281..320 CDD:304600 19/45 (42%)
TPR 636..669 CDD:197478 11/33 (33%)
RING 1037..1083 CDD:238093 16/50 (32%)
HepA <1096..1238 CDD:223627 70/164 (43%)
Helicase_C 1108..1214 CDD:278689 52/111 (47%)
ShprhNP_001071175.1 Linker_histone 435..506 CDD:278939 3/71 (4%)
PHD_SHPRH 651..697 CDD:277022 19/46 (41%)
SNF2_N 707..978 CDD:278600 105/282 (37%)
DEAQ box 810..813 3/3 (100%)
TPR_12 1011..1095 CDD:290160 23/88 (26%)
HepA <1314..1669 CDD:223627 125/371 (34%)
RING 1423..1473 CDD:238093 16/51 (31%)
Helicase_C 1504..1613 CDD:278689 52/111 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0298
Hieranoid 1 1.000
Homologene 1 1.000 H6489
Inparanoid 1 1.050 467 1.000 Inparanoid score I1517
Isobase 1 0.950 0 Normalized mean entropy S6471
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001253
OrthoInspector 1 1.000 T1084838
orthoMCL 1 0.900 OOG5_129526
Panther 1 1.100 LDO PTHR45865
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3395
TreeFam 1 0.960
1110.890

Return to query results.
Submit another query.