DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7376 and SPAC144.05

Sequence 1:NP_001261471.1 Gene:CG7376 FlyBaseID:FBgn0035689 Length:1270 Species:Drosophila melanogaster
Sequence 2:NP_001342916.1 Gene:SPAC144.05 PomBaseID:SPAC144.05 Length:1375 Species:Schizosaccharomyces pombe

Alignment Length:1386 Identity:321/1387 (23%)
Similarity:524/1387 (38%) Gaps:392/1387 (28%)


  Fly    82 VRAREIEMEVGEQVLPLFF------------KDFRGSLEFEVAQQEKEHKRPLKTYVTTKLYDAL 134
            |:..|:.:..|..:|..|.            ..:...|::.....|.|....|.  :.|.|:   
pombe   133 VKGSELILSFGISILDSFLAPQDAILSSGSSSSYTALLDYTFLPSEDEEYSCLD--INTALF--- 192

  Fly   135 YEKHRQTVHVEQERSLDLPKRFQSQLRKYQQRTVSWMLGREQQ--ITQ---VPANFIVLHAIDGI 194
            |:..|:.....:..::....|..|:|..:|.|.:.||..||::  :|.   .|..:......|..
pombe   193 YDCARKLAKSLRFANVSRDPRLSSELLPFQMRVLEWMKRREEEKFLTSNDLPPLWYHCKSLFDDR 257

  Fly   195 TRVFKHKYCLQFYPFEEEIPKISLPP-----GGILADEMGLGKTVEFLAMLLMNPRPQDSYRNDY 254
            .....|.|  .:..|.:|  |..|..     |||||||||:|||:|.|.::|             
pombe   258 MVYVNHVY--GYMTFSKE--KTYLLASGDIRGGILADEMGMGKTLEVLGLVL------------- 305

  Fly   255 WHQRLEEFSDEVPLKRSRISKKDEVFCICTKKHGKRVQCTKCRRWQHEMCMTISEKSDLPHLCPS 319
             |.:|       |:..:.....|:|.       ||.|:.:|                        
pombe   306 -HHQL-------PISLTDTCTFDQVV-------GKNVKYSK------------------------ 331

  Fly   320 CWSELVKSGERLVESGATIIVSPNAIKMQWFEEIHKHISPSLKVLLYFGLHSTFWVSPFDL-AQY 383
                            ||:|::|:.|..||..||..|: |||||..|.|:..:..:....: ...
pombe   332 ----------------ATLIITPSTILDQWLSEIDLHV-PSLKVFHYQGIRKSNGLKSAKIFLDC 379

  Fly   384 DVVLTDYTILRNEIYHTTDFKSDRQMRHQQRYMRPNSPLLMVNWWRVCLDEAQMVESSTSAAAEM 448
            |:|:|.|:.||.|:.:|.  ...|.:||::|::.|.|||:.|.|||:|:|||||||:|.|..|:|
pombe   380 DIVVTSYSDLRFELLYTE--SHSRTLRHEKRHVSPKSPLIDVCWWRICVDEAQMVETSQSNVAQM 442

  Fly   449 VRMLPAINRWAVTGT-----IDELPPLLEFVGR--PEVCRPPDAWQTVDKAFQLNYKCEPLLELL 506
            :..:|.:|.|.|:||     :|:|..|| |:.|  |.......||..:.:..::...|    :|.
pombe   443 IYRIPRVNCWTVSGTPVRSEVDDLFGLL-FLLRYSPMYLYKKQAWMQIIEKKRVREFC----DLF 502

  Fly   507 EHSLWRTCKSKVEHELGIPPQTEVVHRLELSNVESLYYREEHLKCHEQFLAAVAKHTRHNADNSS 571
            ...:.|..|..||.||.:|||..:.....||.||...|::        .|:..||......|.: 
pombe   503 GSLVCRHSKQDVEEELKLPPQHRICMTTRLSVVEETNYQD--------LLSEAAKSLHFFKDRN- 558

  Fly   572 CLASISPQLLRIILKPFLRIRQTCSVP---------------------VVF-----NSNVSSTD- 609
             |.....:.:|   :..:|:||.|..|                     :||     ||..||.: 
pombe   559 -LDLCDEESMR---RWLVRLRQACCHPQVGFGNKSAFGGGPMKSINDVLVFMLEQTNSTFSSLNR 619

  Fly   610 ------------YLHPQDLLARLKSNNENECKTELRT-------WASSY----NGLAAIYFIKND 651
                        |.|.:|....|...:|.....||..       :.|.|    ..|...||..:.
pombe   620 KLYSDKIIVGQIYDHIKDYNKALAIWSEVRIPVELAVKELENVIYNSKYEDHGKNLPINYFGLDH 684

  Fly   652 FPQAIKYYNLLLK----LANEY---NEQNISVDSVLQIHAIYNLLQASSLAPAEHKLTELEHK-- 707
            |.....:|.||.|    :|:.|   ..:....:..|....:...:.:..:......|.|...|  
pombe   685 FIHLRVWYVLLHKIYFFIASAYFSLKNEKFENEFYLLAQDLRRKIMSDVIIKTSKHLEEFSEKFI 749

  Fly   708 -KYQAQMSRLEWKY----------LEDNTRVLESALSSYNENLEKVSELEKRFEGSTLDLLATMV 761
             |...::.||:..|          :||..|:       |.| |....|:..:|....:.|:    
pombe   750 PKKLVKIPRLQKSYAKGLITGHGIIEDYNRL-------YKE-LNDQKEVLIKFRDRLIHLM---- 802

  Fly   762 NHKTSLHDAIWNKVRDDFFRQNISVERLENVNSMAGMLYFMDIWHNKLQNLKSTLIAEFEFLKGV 826
              |..|.|...:...|::         .|::|:.:.:.|.:|::...|.:..:.           
pombe   803 --KLPLLDQESDPTGDEY---------EESLNAQSEISYCIDVYRQMLSDRVAA----------- 845

  Fly   827 MQQACEAIKTGVLLSMEIINFIENVTVCHLTDILDANK------DKPVKPKKHRYCRLCLI---- 881
                         :|..|..|:.:.|......::::.|      ||..:.:..:|    |:    
pombe   846 -------------VSGTINTFVSHETELEKYKLIESIKKSEKSLDKQAEERDKKY----LLYFEE 893

  Fly   882 ----RDSLNQFECL--LFAKKLDEKATVTEGLENPSMEISFIKSIFAFLRSKQDFSEWKEECQSK 940
                |...:|:..|  :.::.||.....|...|..       |::..:.|......|....|| |
pombe   894 REEARPKADQYGSLINIVSRLLDASNRSTSSFETS-------KNMEEYERIDAMAKEQSRICQ-K 950

  Fly   941 LELLSCLQDLVKFQIKYWIEVEYMVKAFDELEMCKM-----RILLT----DDPEEQS--NYRILA 994
            ||     ::|...|:.|...:|| .|...|:....|     .|.|.    ||.::|.  |..|:.
pombe   951 LE-----KELSIIQLTYNSRIEY-YKQLQEISDSLMPPPVSNISLNNYVKDDEKKQKFLNSVIIK 1009

  Fly   995 CQ--LDEQLQFNQ------------YNLQTSQLNFTRLCGRLKYLKHLKEDSADKPCPICQTQDD 1045
            ..  |::::...|            .|.:.|::|   :.|.:..|:.|:|:.::....|...:..
pombe  1010 ASVILEKEISEKQDEASQTTNVAELVNQKISEMN---IPGHIHLLRELEEEKSNTQRKIAHFESR 1071

  Fly  1046 VRYV----------------------------MMVCGHFVCQHCLDSMRRKNGRAGVTKCPLCRQ 1082
            .||:                            :..|||..|..||::..:.:     :.||:|:.
pombe  1072 RRYLTNLYEHIVLKAESHQICIICRDIIKQGFITTCGHLYCSFCLEAWLKHS-----SSCPMCKT 1131

  Fly  1083 --DSPQLYY------------------------------SVRPGAHKSIIGDFSTKISSVVELVL 1115
              :....||                              :.|..::..:...|.:||.::.:.:|
pombe  1132 KLNKNNAYYIGESRDIYSRQEFVTGFNKRDERLEILDDEAYRQISNMELKESFGSKIDTISKHLL 1196

  Fly  1116 KIKGENEQEKIIVFSQWQAILIEIARALSLNGIQF-------RNKCTNKDFDDFKNPLSNVTCLL 1173
            .:|......|::|||||..:|..:.::...|||.|       :|.|..:    ||...| :..|.
pombe  1197 YLKHNELYPKVVVFSQWLDVLDVLHKSFEANGIVFIRFDGKSKNTCLKR----FKEERS-LQVLT 1256

  Fly  1174 MPLSKGSKGLNLIEATHVFLVEPILNPGDERQAIGRIHRFGQKRPTKVHRFIVNETIEENILSLI 1238
            :.....|.||.|..|||||:.||:||.|.|.|||.|:||.||.|||.|:.:||.:|:|.:||:| 
pombe  1257 LHARSQSSGLTLTNATHVFMCEPLLNSGIEMQAISRVHRIGQTRPTFVYYYIVEDTVEGHILNL- 1320

  Fly  1239 TSADDTTTLSTHWDLENMTLD 1259
                   :|:.|..|:.:.||
pombe  1321 -------SLTKHEQLDKLGLD 1334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7376NP_001261471.1 SNF2_N 221..601 CDD:278600 116/409 (28%)
PHD_SF 281..320 CDD:304600 4/39 (10%)
TPR 636..669 CDD:197478 11/41 (27%)
RING 1037..1083 CDD:238093 12/76 (16%)
HepA <1096..1238 CDD:223627 56/149 (38%)
Helicase_C 1108..1214 CDD:278689 40/113 (35%)
SPAC144.05NP_001342916.1 SNF2_N 284..582 CDD:331286 115/387 (30%)
SMC_N <877..>1087 CDD:330553 46/231 (20%)
RING-HC_COP1 1088..1133 CDD:319418 9/50 (18%)
RAD18 1092..>1192 CDD:333230 15/105 (14%)
RING-HC finger (C3HC4-type) 1092..1129 CDD:319418 8/42 (19%)
HepA <1198..1331 CDD:223627 55/146 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 279 1.000 Inparanoid score I666
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001253
OrthoInspector 1 1.000 T1125604
orthoMCL 1 0.900 OOG5_129526
Panther 1 1.100 LDO PTHR45865
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3395
TreeFam 1 0.960
99.050

Return to query results.
Submit another query.