DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7376 and shprh

Sequence 1:NP_001261471.1 Gene:CG7376 FlyBaseID:FBgn0035689 Length:1270 Species:Drosophila melanogaster
Sequence 2:XP_017949475.1 Gene:shprh XenbaseID:XB-GENE-959908 Length:1561 Species:Xenopus tropicalis

Alignment Length:912 Identity:235/913 (26%)
Similarity:361/913 (40%) Gaps:323/913 (35%)


  Fly    30 RWVFKDNLV------EHKEEILI-------CIEKCQ-----NARTRKLKFRSIRQESGSCILVLS 76
            ||:.|..|:      ....:|.:       |:.|.:     |.|.:|           :|||:  
 Frog   183 RWLQKKKLIALYYRSAKSSDIEVGIYLLEACLSKPEFLSQGNGRMKK-----------ACILM-- 234

  Fly    77 HEQTHVRAREIEMEVGEQVLPLFFKDFRGSLEFEVAQQEKEHKRPLKTYVTTKLYDALYEKHRQT 141
                            ::::..|: :|  ::...:...|:|..|.|:.....:|||.:.:.|:|.
 Frog   235 ----------------QRLMETFY-NF--TIPDVIDDNEEESDRELERQNIEELYDYVRQTHQQE 280

  Fly   142 VHVEQERSLDLPKRFQSQLRKYQQRTVSWMLGREQQITQVPANFIVLHAI-DGITRVFKHKYCLQ 205
            .::.|: .:..|... ..||.||...|:|||.:| ...:||:....||.: ..::.:.:.|  :.
 Frog   281 GNLLQQ-DVQHPALI-PVLRPYQNEAVNWMLQKE-NFMEVPSTENTLHPLWREVSTLEEVK--IY 340

  Fly   206 FYPF------EEEIPKISLPPGGILADEMGLGKTVEFLAMLLMNPR------------------- 245
            :.||      |..:|.... ||||||||||||||||.|:::|.:||                   
 Frog   341 YNPFTGCVIRERPVPGHEW-PGGILADEMGLGKTVEVLSLILCHPRKDVRKDVLTLPEGKLVNYF 404

  Fly   246 ----PQDSYRN------------------------------------------------------ 252
                |..|.||                                                      
 Frog   405 IPPPPMKSARNKKEKVADFKSKERIQFPSLRVMILAAIKEISVKKGASIIAIFKYISTIYRYDVQ 469

  Fly   253 ----------------------------------------------------------------- 252
                                                                             
 Frog   470 RNRRLLKRTIEKLISEKIVEQVKGHGLAGSFKLGKNYKENKIQDKSQKLKTKSSKRLQHSLSELR 534

  Fly   253 --------------------DYWHQRLE-----EFSDEVPLKRSRISK-------KDE------- 278
                                ||..|..|     |..|:..:|...:||       |.|       
 Frog   535 DHEKEQPEKVKCIHAAAKDHDYCTQHKESTTDTELKDKGEVKERNVSKLNASLETKHENVYADHP 599

  Fly   279 -----------VF----------CICTK----KHGKRVQCTKCRRWQHEMCMTISEKS--DLPHL 316
                       ||          |||.:    .:..||||.:|..|||..|:...:::  ..|..
 Frog   600 HSQEQVCQTGAVFPFNTADYRFECICGELGLYDYKARVQCLQCHLWQHAECVNYKQENLGVTPFY 664

  Fly   317 CPSCWSELVKSGERLVESGATIIVSPNAIKMQWFEEIHKHI-SPSLKVLLYFGLHSTFWVSPFDL 380
            ||.|...:     :.|.:|||:|:||::|..||.:||::|: |.||.|::|.|:....::.|..|
 Frog   665 CPHCLVAM-----KPVPTGATLIISPSSICHQWVDEINRHVQSSSLHVMVYQGVKKHGFLQPQML 724

  Fly   381 AQYDVVLTDYTILRNEIYHT----TDFKSDRQMRHQQRYMRPNSPLLMVNWWRVCLDEAQMVESS 441
            |:.|||:|.|.:||:|:.:.    ::.:..|:.|:|:|||...|||:.|.|||:|||||||||.:
 Frog   725 AEQDVVITTYDVLRSELNYVDIPHSNSEDGRKFRNQKRYMAVPSPLVAVEWWRICLDEAQMVECT 789

  Fly   442 TSAAAEMVRMLPAINRWAVTGT-----IDELPPLLEFVGRPEVCRPPDAWQTVDKAF------QL 495
            |:.||||...|..||||.|:||     :::|..|:.|:|             ||..:      ||
 Frog   790 TAKAAEMALRLSGINRWCVSGTPVQRGLEDLFGLVLFLG-------------VDPYWVKHWWDQL 841

  Fly   496 NYK--CE----PLLELLEHSLWRTCKSKVEHELGIPPQTEVVHRLELSNVESLYYREEHLKCHEQ 554
            .||  |.    ||.:.:...:||:.|..|..::.||||||.||.|..|.||..:|..:|..|.:.
 Frog   842 LYKPYCRKDPFPLYKFISKIMWRSAKKDVLDQIQIPPQTEDVHWLHFSPVERHFYHRQHEVCCQD 906

  Fly   555 FLAAVAKHTRHNADNSSCLASISPQLLRIILKPFLRIRQTCSVPVVFNSNV----SSTDYLHPQD 615
            .||...|.|    |.:..|:|:..:.:..||.|.||:||.|..|.......    .||  :..::
 Frog   907 ALAKFRKIT----DWALKLSSLDRRTVSSILYPLLRLRQACCHPQAVRGEFLPLQKST--MTMEE 965

  Fly   616 LLARLKSNNENECKTELRTWASSYNGLAAIYFIKNDFPQAIKYYNLLLKLANEYNEQNISVDSVL 680
            ||..|:.....||:...|....:.||||.|:.||.::|:|.:.|..:|:.:.|:.|: :..|| |
 Frog   966 LLTSLQKKCRTECEEAHRQLVCALNGLAGIHIIKGEYPEATELYREVLRSSEEHKEK-LKTDS-L 1028

  Fly   681 QI 682
            |:
 Frog  1029 QV 1030

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7376NP_001261471.1 SNF2_N 221..601 CDD:278600 165/610 (27%)
PHD_SF 281..320 CDD:304600 15/45 (33%)
TPR 636..669 CDD:197478 12/33 (36%)
RING 1037..1083 CDD:238093
HepA <1096..1238 CDD:223627
Helicase_C 1108..1214 CDD:278689
shprhXP_017949475.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6489
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D110877at33208
OrthoFinder 1 1.000 FOG0001253
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.