DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fmt and ppp6r3

Sequence 1:NP_001261470.1 Gene:fmt FlyBaseID:FBgn0035688 Length:996 Species:Drosophila melanogaster
Sequence 2:XP_012816785.1 Gene:ppp6r3 XenbaseID:XB-GENE-5822318 Length:875 Species:Xenopus tropicalis

Alignment Length:1071 Identity:275/1072 (26%)
Similarity:424/1072 (40%) Gaps:304/1072 (28%)


  Fly     1 MFWDKGYAPSANIEALLEKENSTLEEFLDEEDILQECKTQKKNLVNYFTRPEVIRRLVELITTEP 65
            |||......|::|:.|||::..||:|.:||||||||||.|.:.||.:..:.|.:..||..||.||
 Frog     7 MFWKFDLHSSSHIDTLLERDEVTLKELMDEEDILQECKAQNRKLVEFLLKAECLEDLVTFITEEP 71

  Fly    66 SEDVPMSKRFRYANMSCEILTLGLPSLDEKLLNDAETLQLLYSYLEKEPPLNPLLSSFFSKTFSM 130
            .:|:....|::|.|:|||:||..:..::::|..|...|:.||::|..:|||||||:|||||..|:
 Frog    72 PQDMDEKIRYKYPNLSCELLTSDVSQINDRLGEDEALLKRLYAFLLNDPPLNPLLASFFSKVLSI 136

  Fly   131 LFTKKPEQDWFLYQHMCLQLLEYIKSQKTFLDFICKHFDTPVIPDLIMQMMKDIEGGRLKRNLFE 195
            |.::|||           |::|::|.:..|::.|.||..|..|.||:::::..||..:|::::..
 Frog   137 LISRKPE-----------QIVEFLKKKDDFVNLIIKHIGTSAIMDLLLRLLTCIEPPQLRQDVLN 190

  Fly   196 WLTEDKIVERLIAILRNPQETDKHANVADFFCDLINQGRLMR-QTEQENDSFEPAFDGSNPILKT 259
            ||.|:||::||:.|:...|:.|:|:|.:...|::|   ||.| |..|..:|.||     :|:|.|
 Frog   191 WLNEEKIIQRLVEIVHPSQDEDRHSNASQSLCEII---RLSRDQMLQVQNSSEP-----DPLLAT 247

  Fly   260 IEFADTIEALLNVILEPNAQESAILSGISVVLTLIKPITFTDEPNSDRQRLLQKREREIHQEVQE 324
            :|..:.:|.||:.|......||||:|.|.::|||::......|.:.|   |...........|.:
 Frog   248 LEKKEILEQLLSNIFLKEKNESAIVSAIQILLTLLETRRPAFEGHID---LCPPGVNHSAFSVNK 309

  Fly   325 TVITVMAPRLQEFVHILKNPPAKPTLETTAAVLTPPFGKTRLQVCRVFTALLETKHETIQQAICA 389
            .|:..:..||..|..:|.:||....::||..:|.||.|.|||.|.|:..:||:|...:|.:.:..
 Frog   310 NVLAAIQERLPSFHQLLLDPPKTGVMKTTWGILDPPVGNTRLNVIRLIASLLQTNTHSINEELIE 374

  Fly   390 TEYFSLLLDFFKQYCWNNFLHTEMEKALYVVFYNELSNNNTASTEVTDYFTADCLINAFLKVGTE 454
            .....::||.|.:|.|||||||::|..:.::.                                 
 Frog   375 LNTMGVILDMFFKYSWNNFLHTQVEICIALIL--------------------------------- 406

  Fly   455 ESEVEMKNALNDAKRAEGGKDEEGGDIEIEVAAAQEVAAQTPDERQTAAEENQEHEEHMSQVEAA 519
                                                                             
 Frog   407 ----------------------------------------------------------------- 406

  Fly   520 AEATASEDAEPKAQDNEVKNSEVDGESPTDQQESEATLNDLDKTKTVPSPPPSEMQSHLIVNCHL 584
                    |.|             |:||.....||..           ||....:..||.:.|||
 Frog   407 --------ASP-------------GDSPEHSTISEQN-----------SPADHVLLKHLFLKCHL 439

  Fly   585 ISKLVDLWQHNAQAQSAEKGRRLGYMGHLIKILRHITNCISESEHIG------------------ 631
            |.::::.|..|.:.|| |.|:|.||||||.:    |.|||..|...|                  
 Frog   440 IDRILEAWAMNEKRQS-EGGQRYGYMGHLTR----IANCIVHSIEKGPNSVLAHQLIKDLPTDAQ 499

  Fly   632 --------------------DLIT-----SSLSDEDEVK---------LWQSLIDAETGEFSLAV 662
                                ||:|     ||..||.|.|         :.|:..|.:       :
 Frog   500 ERWETFCTSSLGETNKRNTVDLVTTRHIHSSSDDEIEFKDPGFSQDSAIQQAFSDYQ-------M 557

  Fly   663 KQQTKLLADCNPHEENQYNDGS----------NDYTGEINAWNVGNLPYREVDCSELNNTLQD-- 715
            :|.|....|.....:.::.|..          :|....:||....|:...|..|.|......|  
 Frog   558 QQMTSNFIDQFGFNDEKFADQDDIGNVSFDRVSDINFSLNANESANIALFEACCKERIQQFDDGG 622

  Fly   716 -----------IFFAIDQNRFQFGRNIDDEDDDDDEHGDHSGGGDGHGHGMFTKNSNTLN----- 764
                       |.|..:..|.....:.|.|:..|.|..:..      ..|:|  .|:|:|     
 Frog   623 SDEEDIWEEKNIAFPQETQRRSSSGSTDSEESTDSEEEETV------KQGLF--ESSTVNHEDKM 679

  Fly   765 ----NLADPWDIQFAVLSSAPTQVN---TGTANWGTDFNSDNFADFDAHFSTFGSDLGMPISAPP 822
                |.|..|...|.:........|   .|:..|.|:....:.....|.||.|.|.:..      
 Frog   680 EVDANEASNWTANFDIPMETAHVANLDSVGSDVWSTEEPLSSKESGWASFSEFTSQIST------ 738

  Fly   823 GEEEEEDSSPAPESATQVNPEEERQPAESIGLAVGKGVQDNLACTDDQQAEYDNNANVEKAISDK 887
             :|....|||       |..|...:|.:.  |:|....|..:....|  |..|....||.|  |:
 Frog   739 -KETVRSSSP-------VEMETSTEPVDP--LSVNASAQTEVTVAMD--AVSDGEEEVENA--DQ 789

  Fly   888 LAES----SVVETAAIVTRLQSVLLDGEDD---YEDDEG-MWTKPLGADRPSETEQI-TPISNGP 943
            :.|:    |:.||.       |:.:|.:.:   ::.:|| :.|....|.:....|.. |.:.|.|
 Frog   790 MTETVMNGSMKETL-------SLTVDAKTETAVFKSEEGKLTTSHDSACKYGVVENFDTAMENPP 847

  Fly   944 DSKVNELGLPFSNHANDISSNN--VDGHEAN 972
            .|:      |..:.....:|..  |||..||
 Frog   848 PSQ------PSGSSQEQRTSEQIAVDGASAN 872

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fmtNP_001261470.1 SAPS 129..465 CDD:282368 96/337 (28%)
ppp6r3XP_012816785.1 SAPS 134..519 CDD:282368 130/542 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40111262
eggNOG 1 0.900 E1_KOG2073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 327 1.000 Inparanoid score I2296
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000556
OrthoInspector 1 1.000 T600543
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R385
TreeFam 1 0.960
87.780

Return to query results.
Submit another query.