DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fmt and ppp6r2a

Sequence 1:NP_001261470.1 Gene:fmt FlyBaseID:FBgn0035688 Length:996 Species:Drosophila melanogaster
Sequence 2:NP_001020680.1 Gene:ppp6r2a ZFINID:ZDB-GENE-030131-5428 Length:878 Species:Danio rerio

Alignment Length:1042 Identity:253/1043 (24%)
Similarity:427/1043 (41%) Gaps:251/1043 (24%)


  Fly     1 MFWDKGYAPSANIEALLEKENSTLEEFLDEEDILQECKTQKKNLVNYFTRPEVIRRLVELITTEP 65
            |||......:::|:.||::|..||.|.::|||:|||||.|.:.|:.:.::...::.||.|||.||
Zfish     1 MFWKFDLNNTSHIDQLLDREGVTLRELMEEEDVLQECKAQNRKLLLFLSKDHCMQELVTLITEEP 65

  Fly    66 SEDVPMSKRFRYANMSCEILTLGLPSLDEKLLNDAETLQLLYSYLEKEPPLNPLLSSFFSKTFSM 130
            ..|:....||::.|::||:||..:..:::||..|...|:.||.:||:||||||||:||||||...
Zfish    66 PADLEEKTRFKFPNIACELLTSDVALINDKLGGDESLLEKLYHFLEQEPPLNPLLASFFSKTIGN 130

  Fly   131 LFTKKPEQDWFLYQHMCLQLLEYIKSQKTFLDFICKHFDTPVIPDLIMQMMKDIEGGRLKRNLFE 195
            |..:|.:           |::.:::.:..|:..:..|.|...:.||:::::..:|...|:..:..
Zfish   131 LIARKTD-----------QVISFLRKKHNFISLVLNHIDASAMMDLLLRLISCVEPAPLRMEVLN 184

  Fly   196 WLTEDKIVERLIAILRNPQETDKHANVADFFCDLINQGRLMRQTEQENDSFEPAFDGSNPILKTI 260
            ||.|:::::||..::...::.::.:|.:...||:|   ||.|  :|.|...|  ...|:|:|..:
Zfish   185 WLNEERLIQRLTELMHTGRDEERQSNASQTLCDII---RLSR--DQANQLSE--VTDSDPLLAVL 242

  Fly   261 EFADTIEALLNVILEPNAQESAILSGISVVLTLIKPITFTDEPNSDRQRL-----LQKREREIHQ 320
            |..:.:..||..:.|....|:::::|..|:|||::         |.|..|     |..:..|...
Zfish   243 ESQENVAELLKNMFEGERSEASVVNGTQVLLTLLE---------SRRSGLEGLMDLYSQGCERSY 298

  Fly   321 EVQETVITVMAPRLQEFVHILKNPPAKPTLETTAAVLTPPFGKTRLQVCRVFTALLETKHETIQQ 385
            .|..:::..:.|.|::|..:|.|||.:..:.||..||..|.|..||.|.|:..:||:|...:|.|
Zfish   299 TVNSSILRAIEPHLKDFQQLLLNPPTRSAILTTVGVLEQPLGSARLHVARLVASLLQTCDLSICQ 363

  Fly   386 AICATEYFSLLLDFFKQYCWNNFLHTEMEKALYVVFYNELSNNNTASTEVTDYFTADCLINAFLK 450
            .||......||||.|.:|.||||||.::|..:..:.      |::|..:|               
Zfish   364 EICRLNTMDLLLDLFFKYTWNNFLHLQVELCVASIL------NHSAHADV--------------- 407

  Fly   451 VGTEESEVEMKNALNDAKRAEGGKDEEGGDIEIEVAAAQEVAAQTPDERQTAAEENQEHEEHMSQ 515
                                                       |.|.        .|.|||..: 
Zfish   408 -------------------------------------------QNPG--------LQNHEERPA- 420

  Fly   516 VEAAAEATASEDAEPKAQDNEVKNSEVDGESPTDQQESEATLNDLDKTKTVPSPPPSEMQSHLIV 580
                                            ||.|..|.|......:....:|....:.::|..
Zfish   421 --------------------------------TDNQTEEGTPGQNSSSDPANTPIQDALVANLFQ 453

  Fly   581 NCHLISKLVDLWQHNAQAQSAEKGRRLGYMGHLIKILRHITNCISES---EHIGDLITSSLSDED 642
            :|.|:.:::|.|:.|.:.|: |.|||.|.||||.:|...:...:.:.   ..|.|||..  ..||
Zfish   454 HCRLVQRILDAWEENDKIQT-EGGRRRGNMGHLTRIANTVVQNLEKGLAHSQINDLIKE--LPED 515

  Fly   643 EVKLWQSLIDAETGEFSLAVKQQTKLLADCNPHEENQYNDGSNDYTGEIN--------------A 693
            ....|:|.:.....|.:.  :....|::..|.|..::.:|..:.:..:::              |
Zfish   516 CRGRWESFVGETLRETNR--RNTVDLVSTHNLHSSSEDDDMESPFPNDLSIQQAFSDYQIQQMTA 578

  Fly   694 WNVGNLPYREVDCSELNNTLQDIFFAIDQNRFQFGRNIDDED-------------------DDDD 739
            ..|....:.:.:.||.:..:...|..|.:..|    |||.:|                   ||.:
Zfish   579 NFVDQFGFNDEEFSEHDENINAAFDRIAEINF----NIDADDHSANAAAFEACCKERIQQFDDCE 639

  Fly   740 EHGDHSGGGDGHGHGMFTKNSNTLNNLADPWDIQFAVLSSAPTQVNTGTANWGTDFNSDNFADFD 804
            |..|                      :.|..:|.:|      ||:.: .:.:|...:||:     
Zfish   640 EEED----------------------IWDEKEINYA------TQIKS-RSRFGVSLSSDS----- 670

  Fly   805 AHFSTFGSDLGMPISAPPGEEEEEDSSPAPESATQV-NP-------EEERQPAESIGLAV---GK 858
            :..|...:..|...||...|:.||::||...:..|. ||       |.|...:.|.|.:.   .:
Zfish   671 SPKSAVRNGGGGRGSASEEEDVEEEASPQQSAGAQTQNPGWTASFGEAEVSASGSWGNSPQQGSE 735

  Fly   859 GVQDN----------LACTDDQQAEYDNNANVEK--AISDKLA---ESSVVETAAIVTRLQSVLL 908
            |.||.          .:.|:..|.|.......||  |.||...   |.|..:.|.:|....|  .
Zfish   736 GQQDTGWASFTEFQPFSSTESSQTEGQPQQGEEKNLASSDSATGAWEESSGQKAPLVASDSS--S 798

  Fly   909 DGEDDYEDDEGMWTKPLGADRPSETEQITPISNGPDSKVNELGLPFSNHANDISSNNVDGHEANI 973
            .|..|.|:|.|. .|..|:.:....:.....|:.|...:.:|.:      .|.|.::....|::.
Zfish   799 SGGSDSEEDPGE-NKTQGSPKTPANQTTASSSDVPTEALKKLSI------TDSSESSAPTEESDA 856

  Fly   974 TT 975
            ||
Zfish   857 TT 858

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fmtNP_001261470.1 SAPS 129..465 CDD:282368 84/341 (25%)
ppp6r2aNP_001020680.1 SAPS 128..537 CDD:309582 122/546 (22%)
Glutenin_hmw <697..>820 CDD:281191 32/126 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40124459
eggNOG 1 0.900 E1_KOG2073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 344 1.000 Inparanoid score I2269
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000556
OrthoInspector 1 1.000 T596154
orthoMCL 1 0.900 OOG5_128556
Panther 1 1.100 O PTHR12634
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R385
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.