DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fmt and Ppp6r3

Sequence 1:NP_001261470.1 Gene:fmt FlyBaseID:FBgn0035688 Length:996 Species:Drosophila melanogaster
Sequence 2:XP_008758350.1 Gene:Ppp6r3 RGDID:1307145 Length:879 Species:Rattus norvegicus

Alignment Length:1076 Identity:274/1077 (25%)
Similarity:437/1077 (41%) Gaps:317/1077 (29%)


  Fly     1 MFWDKGYAPSANIEALLEKENSTLEEFLDEEDILQECKTQKKNLVNYFTRPEVIRRLVELITTEP 65
            |||......|::|:.|||:|:.||:|.:||||:|||||.|.:.|:.:..:.|.:..||..|..||
  Rat     1 MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEP 65

  Fly    66 SEDVPMSKRFRYANMSCEILTLGLPSLDEKLLNDAETLQLLYSYLEKEPPLNPLLSSFFSKTFSM 130
            .:|:....|::|.|:|||:||..:..::::|..|...|..|||:|..|.||||||:|||||..|:
  Rat    66 PQDMDEKIRYKYPNISCELLTSDVSQMNDRLGEDESLLMKLYSFLLNESPLNPLLASFFSKVLSI 130

  Fly   131 LFTKKPEQDWFLYQHMCLQLLEYIKSQKTFLDFICKHFDTPVIPDLIMQMMKDIEGGRLKRNLFE 195
            |.::|||           |:::::|.::.|:|.|.||..|..|.||:::::..||..:.::::..
  Rat   131 LISRKPE-----------QIVDFLKKKRDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQDVLN 184

  Fly   196 WLTEDKIVERLIAILRNPQETDKHANVADFFCDLINQGRLMR-QTEQENDSFEPAFDGSNPILKT 259
            ||.|::|::||:.|:...||.|:|:|.:...|:::   ||.| |..|..:|.||     :|:|.|
  Rat   185 WLNEERIIQRLVEIVHPSQEEDRHSNASQSLCEIV---RLSRDQMLQVQNSTEP-----DPLLAT 241

  Fly   260 IEFADTIEALLNVILEPNAQESAILSGISVVLTLIKPITFTDEPNSDRQRLLQKREREIHQE--- 321
            :|..:.||.||:.|......||||:|.|.::|||::    |..|..           |.|.|   
  Rat   242 LEKQEIIEQLLSNIFHKEKNESAIVSAIQILLTLLE----TRRPTF-----------EGHIEICP 291

  Fly   322 ---------VQETVITVMAPRLQEFVHILKNPPAKPTLETTAAVLTPPFGKTRLQVCRVFTALLE 377
                     |.::|:..:..||..|..:|..||.|..::||..:|.||.|.|||.|.|:.::||:
  Rat   292 PGMSHSACSVNKSVLEAIRGRLGSFHELLLEPPKKSVMKTTWGILDPPVGNTRLNVIRLISSLLQ 356

  Fly   378 TKHETIQQAICATEYFSLLLDFFKQYCWNNFLHTEMEKALYVVFYNELSNNNTASTEVTDYFTAD 442
            |...:|...:.......::||.|.:|.|||||||::|..:.::..:...|               
  Rat   357 TNTSSINGDLMELNSIGVILDMFFKYTWNNFLHTQVEICIALILASPFEN--------------- 406

  Fly   443 CLINAFLKVGTEESEVEMKNALNDAKRAEGGKDEEGGDIEIEVAAAQEVAAQTPDERQTAAEENQ 507
                                       ||.|                                  
  Rat   407 ---------------------------AENG---------------------------------- 410

  Fly   508 EHEEHMSQVEAAAEATASEDAEPKAQDNEVKNSEVDGESPTDQQESEATLNDLDKTKTVPSPPPS 572
                                                            |:.|.|      |...:
  Rat   411 ------------------------------------------------TITDQD------SAGDN 421

  Fly   573 EMQSHLIVNCHLISKLVDLWQHNAQAQSAEKGRRLGYMGHLIKILRHITNCISESEHIGDLITSS 637
            .:..||...|.||.:::|.|..|.:.| ||.|||.||||||.:    |.|||..|...|.  .|:
  Rat   422 LLLKHLFQKCQLIERILDAWDTNEKKQ-AEGGRRHGYMGHLTR----IANCIVHSTDKGP--NSA 479

  Fly   638 LSDE------DEVK-LWQSLIDAETGEFSLAVKQQT-KLLADCNPH---------------EENQ 679
            |..:      |.|: .|::......||   |.|:.| .|:..|:.|               :::.
  Rat   480 LVQQLIKGLPDGVRERWEAFCTDSLGE---ANKRNTADLVTTCHIHSSSDDEIDFKDTGFSQDSS 541

  Fly   680 YNDGSNDYTGEINAWN-----------------VGNLPYREVDCSELNNTLQD-------IFFAI 720
            .....:||..:....|                 :||:.:..|  |::|.||..       :|.|.
  Rat   542 LQQAFSDYQMQQMTSNFIDQFGFNDEKFADQDDIGNVSFDRV--SDINFTLNTNESGNIALFEAC 604

  Fly   721 DQNRF-QFGRNIDDEDD---------------------DDDEHGDHSGGGDGHGHGMFTKNS-NT 762
            .:.|. ||.....||:|                     .|.|....|...||....:|..:| ||
  Rat   605 CKERIQQFDDGGSDEEDIWEEKHIAFTPESQRRSSSGSTDSEESTDSEEEDGAKQDLFESSSANT 669

  Fly   763 LN----NLADP--W----DIQFAVLSSAPTQVNTGTANWGT-------DFNSDNFADFDAHFST- 809
            .:    :|.:|  |    |:.......||.. :.|:..|.|       :....:|::|.:..|| 
  Rat   670 EDKMEVDLNEPPTWSANFDVPMETTHGAPLD-SVGSDVWSTEEPMPTKETGWASFSEFTSSLSTK 733

  Fly   810 ----FGSDLGMPISAPP-----------GEEEEEDSSPAPESATQVNPEEERQPAESIGLAV-GK 858
                ..|.:.|..|..|           ..:.|...|.|.|:::  :.||:.:..:.:...| ..
  Rat   734 ESLRSNSPVEMETSTEPVGPLTPGAAALASQPEAPGSVAMEASS--DGEEDAESTDKVTETVMNG 796

  Fly   859 GVQDNLACTDDQQAEYDNNANVEKAISDKLAESSVVETAAIVTRLQSVLLDGEDDYEDDEGMWTK 923
            |:::.|:.|.|        |..|.|:..::.: |..|...:.|...:...|.|:..|..|...|.
  Rat   797 GMKETLSLTVD--------AKTETAVFKRVLK-SYREEEKLSTSQDAACKDTEETPESAEAKCTA 852

  Fly   924 PLGADRPSETEQITPISNGPDSKVNELGLPFSNHAN 959
            |.           || ::.|:.:.::..:|.....|
  Rat   853 PR-----------TP-NSSPEQRTDQPSMPGDTSVN 876

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fmtNP_001261470.1 SAPS 129..465 CDD:282368 99/349 (28%)
Ppp6r3XP_008758350.1 SAPS 128..513 CDD:282368 142/559 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40100668
eggNOG 1 0.900 E1_KOG2073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 286 1.000 Inparanoid score I2713
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000556
OrthoInspector 1 1.000 T617557
orthoMCL 1 0.900 OOG5_128556
Panther 1 1.100 LDO PTHR12634
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
98.750

Return to query results.
Submit another query.