DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fmt and ekc1

Sequence 1:NP_001261470.1 Gene:fmt FlyBaseID:FBgn0035688 Length:996 Species:Drosophila melanogaster
Sequence 2:NP_588263.2 Gene:ekc1 PomBaseID:SPCC663.01c Length:838 Species:Schizosaccharomyces pombe

Alignment Length:1005 Identity:213/1006 (21%)
Similarity:375/1006 (37%) Gaps:269/1006 (27%)


  Fly     1 MFW----DKGYAPSANIEALLEK--ENSTLEEFLDEEDILQECKTQKKNLVNYFTRPEVIRRLVE 59
            |||    ..|:..|:.|||:|:|  :...|:|.|:|..:|.|||:....|:.|..:|||:.:|::
pombe     1 MFWRLGQGFGFQSSSAIEAILDKPEDEINLKELLEENGVLDECKSHNPKLLEYLCKPEVLSQLID 65

  Fly    60 LITTEPSEDVPMS-------KRFRYANMSCEILTLGLPSLDEKLLNDAETLQLLYSYLEKEPPLN 117
            .|......::|.:       :..|.:.::.|||:..:.|:.|..:.:...:..|:|:|:.|.|||
pombe    66 YILEVDETEIPSADGGYEEPEHTRLSYIASEILSSDVWSICEACVENKTLMVKLWSFLDSEGPLN 130

  Fly   118 PLLSSFFSKTFSMLFTKKPEQDWFLYQHMCLQLLEYIKSQKTFLDFICKHFDTPVIPDLIMQMMK 182
            ||.:|:|:|.......||.|           :.:.:|:|...|::.|.:|.:|..|.||:::.: 
pombe   131 PLQASYFAKVNEHFLDKKTE-----------ETVAFIQSIDNFVEKILRHAETSAIMDLLLKFI- 183

  Fly   183 DIEGGRLKRNLFEWLTEDKIVERLIAILRNPQETDKHANVADFFCDLINQGRLMRQTEQENDSFE 247
            .::.......:.:||....:::.|:.:|....:.|....|||....:|         ....:|.|
pombe   184 SMDRCNTAIGIADWLYSQGLIQSLLRLLSPYVDPDVQFTVADVIKAII---------AISANSNE 239

  Fly   248 PAFDGSNPILKTIEFADTIEALLNVILEPNAQESA--ILSGISVVLTLIKPITFTDEPNSDRQ-- 308
            |...|.|.:.:.:....||..|.:.:.:..|..||  :::|:|:|:.||:      :.|||..  
pombe   240 PGVIGPNSLSRELVSRQTITTLTDYMTDSKAPHSATSLINGVSIVIELIR------KNNSDYDVT 298

  Fly   309 RLLQKREREIHQEVQE------TVITVMAPRLQEFVHILKNPPAKPTLETTAAVLTPPFGKTRLQ 367
            .:|| ...:.|.....      |::.:.|.::..|..||..|..:..|..|:.....|.|..|.:
pombe   299 PVLQ-MPLDTHPPTTRDPIYLGTMLRLFAEKIPVFQKILLKPSTESDLMPTSFGKIKPLGFERFR 362

  Fly   368 VCRVFTALLETKHETIQQAICATEYFSLLLDFFKQYCWNNFLHTEMEK---ALYVVFYNELSNNN 429
            :|.::..||.          |:.  .|||.|       .|.....|::   ..|:..:|..:.:.
pombe   363 ICELYAELLH----------CSN--MSLLSD-------PNGEAMVMQRDHLRDYLFRHNSCARDL 408

  Fly   430 TASTEVTDYFTADCLINAFLKVGTEESEVEMKNALNDAKRAE---GGKDEEGGDIEIEVAAAQEV 491
            ..|.|..|                 :|....||: .|.|..|   |.:|..|...:|   ....:
pombe   409 VMSDEDDD-----------------DSTFSDKNS-KDFKETEDMNGAEDMHGRAPQI---TKDNL 452

  Fly   492 AAQTPDERQTAAEENQEHEEHMSQVEAA---------AEATASEDAEPKAQDNEVKNSEVDGESP 547
            ...|.|...:.||...| ||:...:|.|         |.:..|.:..|::...:.|...|.|   
pombe   453 NLTTTDSPMSEAEPVSE-EEYKDVMETAKALHHGDDDAASDTSYEPLPESVIEDAKKLPVIG--- 513

  Fly   548 TDQQESEATLNDL----------------------DKTKTVPSPPPSEMQSHLIV-----NCHLI 585
             |..:.|...|::                      |..:.|.:.|..:.|::.:.     ...:.
pombe   514 -DFLKIEFIQNNVIPTILDHFFDYPWNNFLHNVVYDVVQQVLNAPMDKDQNYALAVDMFKQGKIT 577

  Fly   586 SKLVDLWQHNAQAQSAEKGRRLGYMGHLIKILRHITNCISESEHIGDLITSSLSDEDEVKL---- 646
            .|:|...:.|.:..:...|.|.||||||..|...:...:   ||.     ||..|::.:.|    
pombe   578 EKIVYGQELNDKKVAKPSGFRAGYMGHLTIIADEVVKFV---EHY-----SSTFDQELLNLINDE 634

  Fly   647 -WQSLIDAETGEFSLAVKQQTKLLADCNPHEENQYNDGSNDYTGEINAWNVGNLPYREVDCSEL- 709
             ||:.::              |.|.:....:        |...|.:....||.|  .::|..|: 
pombe   635 KWQNFVN--------------KTLVETRNRD--------NQLLGGLEPSMVGYL--EDMDEGEML 675

  Fly   710 -NNTLQDIFFAIDQNRFQFGRNIDDEDDDDD--------EHGDHSGGGDGHGHGMFTKNSNTLNN 765
             .|.|.::.||::|       .::....|||        .|...|...|.             .|
pombe   676 DANNLPEMQFALEQ-------ELESNSSDDDVVEVHRELSHNSSSNDEDD-------------GN 720

  Fly   766 LADPWDIQFAVLSSAPTQVNTGTANWGTDFNSDNFADF------DAHFSTFGSDLGMPISAPPGE 824
            ..||...:.:      .:::..:||.....|.|:||.:      |.:.:.|.|          .:
pombe   721 DEDPLSREMS------RRLSFESANDSDQDNRDHFAQYMSQQISDNNANQFSS----------SD 769

  Fly   825 EEEEDSSPAPESATQVNPEEERQPAESIGLAVGKGVQDNLACTDDQQAEYDNNANVEKAISDKLA 889
            |:::|.....|..::.|  |.:.|                      ::.:..|.:..:..||...
pombe   770 EDDDDDDEVVEWVSRGN--ENKYP----------------------RSNFFINGSDREDFSDSEE 810

  Fly   890 ESSVVETAAIVTRLQSVLLDGEDDYEDDEG 919
            |                  ||.|..:||.|
pombe   811 E------------------DGNDSSDDDRG 822

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fmtNP_001261470.1 SAPS 129..465 CDD:282368 72/349 (21%)
ekc1NP_588263.2 SAPS 141..653 CDD:282368 124/615 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1432
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000556
OrthoInspector 1 1.000 T1124318
orthoMCL 1 0.900 OOG5_128556
Panther 1 1.100 LDO PTHR12634
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R385
TreeFam 1 0.960
87.950

Return to query results.
Submit another query.