DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fmt and Ppp6r1

Sequence 1:NP_001261470.1 Gene:fmt FlyBaseID:FBgn0035688 Length:996 Species:Drosophila melanogaster
Sequence 2:NP_766482.2 Gene:Ppp6r1 MGIID:2442163 Length:856 Species:Mus musculus

Alignment Length:1065 Identity:245/1066 (23%)
Similarity:398/1066 (37%) Gaps:314/1066 (29%)


  Fly     1 MFWDKGYAPSANIEALLEKENSTLEEFLDEEDILQECKTQKKNLVNYFTRPEVIRRLVELITTEP 65
            |||......|::::.|||||:.:|.|.|||||:|||||...:.|:::..:|..::.:|..:|.||
Mouse     1 MFWKFDLHTSSHLDTLLEKEDLSLPELLDEEDVLQECKVVNRKLLDFLLQPSHLQAMVAWVTQEP 65

  Fly    66 SEDVPMSKRFRYANMSCEILTLGLPSLDEKLLNDAETLQLLYSYLEKEPPLNPLLSSFFSKTFSM 130
            ........|::|.:::|||||..:|.:::.|..|...|..||.:|:....|||||:|||||...:
Mouse    66 PASGEERLRYKYPSVACEILTSDVPQINDALGADESLLNRLYGFLQSGDSLNPLLASFFSKVMGI 130

  Fly   131 LFTKKPEQDWFLYQHMCLQLLEYIKSQKTFLDFICKHFDTPVIPDLIMQMMKDIEGGRLKRNLFE 195
            |..:|.:           ||:.:::.:..|:|.:.:|..|..|.||:::::..:|..:|::::|.
Mouse   131 LINRKTD-----------QLVSFLRKKDDFVDLLLRHIGTSAIMDLLLRLLTCVERPQLRQDVFN 184

  Fly   196 WLTEDKIVERLIAILRNPQETDKHANVADFFCDLINQGRLMRQTEQENDSFEPAFDGSNPILKTI 260
            ||.|:|||:|||..:...::.::|:|.:...||:|...|  .|..|..||.||     :.:|.|:
Mouse   185 WLNEEKIVQRLIEQIHPSKDDNQHSNASQSLCDIIRLSR--EQMIQGQDSPEP-----DQLLATL 242

  Fly   261 EFADTIEALLNVILEPNAQESAILSGISVVLTLIKPITFTDEPNSD---RQRLLQKREREIHQEV 322
            |..:|||.||:.:.|....:|.|:|||.|:|||::|    ..|.||   ........:.::....
Mouse   243 EKQETIEQLLSNMFEGEQCQSVIVSGIQVLLTLLEP----RRPRSDSVTMNNFFSSVDGQLELLA 303

  Fly   323 QETV---------ITVMAPRLQEFVHILKNPPAKPTLETTAAVLTPPFGKTRLQVCRVFTALLET 378
            |..:         :..:.|||..|..:|..||....|:.|...|.||.|.|||.|.::..:.|..
Mouse   304 QGALDDALSSMGALHALRPRLDRFHQLLLEPPKLEPLQMTWGSLAPPLGNTRLHVVKLLASALSA 368

  Fly   379 KHETIQQAICATEYFSLLLDFFKQYCWNNFLHTEMEKALYVVFYNELSNNNTASTEVTDYFTADC 443
            ....:.|.:...:..:.|||.|..|.:|||||                                 
Mouse   369 NAAALTQELLVLDVPNTLLDLFFHYVFNNFLH--------------------------------- 400

  Fly   444 LINAFLKVGTEESEVEMKNALNDAKRAEGGKDEEGGDIEIEVAAAQEVAAQTPDERQTAAEENQE 508
                                                                             
Mouse   401 ----------------------------------------------------------------- 400

  Fly   509 HEEHMSQVEAAAEATASEDAEPKAQDNEVKNSEVDGESPTDQQESEATLNDLDKTKTVPSPPPSE 573
                 :|||....|..|....|            |..|.|                    |.|:.
Mouse   401 -----AQVEVCVSAMLSSGPPP------------DSSSET--------------------PVPNP 428

  Fly   574 MQSHLIVNCHLISKLVDLWQHNAQAQSAEKGRRLGYMGHLIKILRHITNCISE---SEHIGDLIT 635
            :..||:.:|.|:.:::..|:.|.:.||. .|.|.||||||.::...:.....:   :|.:|.|: 
Mouse   429 IVKHLLQHCRLVERILASWEENDRVQSG-GGPRKGYMGHLTRVANAVVQNAEQGPNAEQLGQLL- 491

  Fly   636 SSLSDEDEVKLWQSLIDAETGEFSLAVKQQTKLLADCNPHEENQYNDGSNDYTGEINAWNVGNL- 699
            ..|.:|.:.: |::.:.....|.:   |:.|..|.  |.|..:..:|..:|...|.|......| 
Mouse   492 KELPEEQQQR-WEAFVSGPLAETN---KKNTVDLV--NTHHLHSSSDDEDDRLKEFNFPEEAVLQ 550

  Fly   700 -PYREVDCSELNNTLQDIFFAIDQN----------------RFQFGRNIDDE------------- 734
             .:.:.....:.:...|.|...|:.                ...|..|.|||             
Mouse   551 QAFMDFQMQRMTSAFIDHFGFNDEEFGEQEESVNAPFDKTANITFSLNADDENPNANLLEICYKD 615

  Fly   735 -----DDDDDEHGDHSGGGDGHGHGMFTKNSNTLNNLADPWDIQFAVLSSAPTQVNTG--TANWG 792
                 ||:::|..:..|..:..|.....:.|..:.          |..:|.|..|.:|  |.:..
Mouse   616 RIQQFDDEEEEEEEGQGSAESDGEYGAWQGSQPVR----------ASQASQPPGVRSGGSTDSEE 670

  Fly   793 TDFNSDNFADFDAHFSTFG----SDLGMPISAPPGE-------------------EEEED----- 829
            .|...|...|..|..:..|    |....|.:.|||.                   .:|.|     
Mouse   671 EDEEEDEEEDEGAEQAACGRTSPSSFPSPSTQPPGPSWTATFDTVPMDAPTGPPVSKEADMSSIQ 735

  Fly   830 --SSPAPESATQVNPEEERQPAESIGLAVGKGVQDNLACTDDQQAEYDNNANVEKAISDKLAES- 891
              |||....:.|:..::...|                            :|..|...|.|:||. 
Mouse   736 IPSSPPAHGSPQLRSQDPTHP----------------------------SAPQEVTDSSKVAEPL 772

  Fly   892 SVVETAAIVTRLQSVLLDGEDDYEDDEGMWTKPLGADRPSETEQITPISNGPDSKVNE------- 949
            :..:....|..:|:.|          .||.:.|...|  |.|..  |.::.||.|.::       
Mouse   773 APCQALVSVADVQATL----------HGMRSAPSSLD--SATRD--PSTSVPDFKAHQSPQTMEG 823

  Fly   950 ------LGLPFSNHANDISSNNVDG 968
                  ||||.|..|.::.:.:..|
Mouse   824 KRSPEHLGLPQSQSALEMPNGSTPG 848

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fmtNP_001261470.1 SAPS 129..465 CDD:282368 87/348 (25%)
Ppp6r1NP_766482.2 Interaction with PPP6C. {ECO:0000250} 10..403 136/518 (26%)
DUF445 26..>199 CDD:282184 64/184 (35%)
SAPS 128..519 CDD:282368 123/554 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40118443
eggNOG 1 0.900 E1_KOG2073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 337 1.000 Inparanoid score I2357
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000556
OrthoInspector 1 1.000 T615449
orthoMCL 1 0.900 OOG5_128556
Panther 1 1.100 O PTHR12634
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R385
TreeFam 1 0.960
109.780

Return to query results.
Submit another query.