DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and PZF1

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_015512.1 Gene:PZF1 SGDID:S000006390 Length:429 Species:Saccharomyces cerevisiae

Alignment Length:122 Identity:34/123 (28%)
Similarity:51/123 (41%) Gaps:16/123 (13%)


  Fly   321 HL----CIYCGKVYSRKYGLKIHIRTHTG---FKPLKCKF--CLRPFGDPSNLNKHVRLHLQTHP 376
            ||    |.:|.|.:.|.|.|:.||..|..   ..|.:|.|  |.:.|...|.|..|::   ..||
Yeast   159 HLHKLTCPHCNKSFQRPYRLRNHISKHHDPEVENPYQCTFAGCCKEFRIWSQLQSHIK---NDHP 220

  Fly   377 SSSAGVADG---GASGADMDGDVDIEGETDADYQCHVC-HKSFPRRRDLQRHMETRH 429
            .....:...   |.:|..|...:..:.....:::||:| ..||.|:.||..|..:.|
Yeast   221 KLKCPICSKPCVGENGLQMHMIIHDDSLVTKNWKCHICPDMSFSRKHDLLTHYGSIH 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 21/68 (31%)
C2H2 Zn finger 323..343 CDD:275368 8/20 (40%)
zf-H2C2_2 336..358 CDD:290200 8/27 (30%)
C2H2 Zn finger 351..371 CDD:275368 7/22 (32%)
zf-C2H2 406..427 CDD:278523 9/22 (41%)
C2H2 Zn finger 408..427 CDD:275368 9/20 (45%)
PZF1NP_015512.1 COG5048 46..427 CDD:227381 34/123 (28%)
C2H2 Zn finger 54..74 CDD:275368
C2H2 Zn finger 82..102 CDD:275368
C2H2 Zn finger 110..130 CDD:275368
C2H2 Zn finger 136..155 CDD:275368
C2H2 Zn finger 165..185 CDD:275368 8/20 (40%)
C2H2 Zn finger 196..216 CDD:275368 7/20 (35%)
C2H2 Zn finger 224..244 CDD:275368 3/20 (15%)
C2H2 Zn finger 255..277 CDD:275368 9/22 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.