DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and zfat

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_012820307.1 Gene:zfat XenbaseID:XB-GENE-981323 Length:1212 Species:Xenopus tropicalis

Alignment Length:439 Identity:89/440 (20%)
Similarity:140/440 (32%) Gaps:122/440 (28%)


  Fly    78 CSMAIPTSALLGSTVMPTDGSRSHCQ--LSNGELIVSGSLLRQIKLSEDVYSFNAIFELHG---G 137
            |::..|..:.|...|     |.:|.:  |:.|::|:....|.....|.|  ..:|:....|   |
 Frog    19 CNLFSPNHSELVRHV-----SDNHTEEGLTAGDIIIPLRPLAASNRSGD--DLSAVKRKRGRPKG 76

  Fly   138 QVRVRLVRDVAREDEIVAWFGEELVLLMGIPFLTPLNIQGNSRYMCHLCHLTFETPHPLKIHLAL 202
            ..:..:..:.:.|....| .|:.|......|...|.|::      |..|..||.....||.|:.:
 Frog    77 STKKSIAEEESTEQSSNA-SGDLLPETDEKPDPVPENLE------CRKCSRTFSNVRQLKKHICI 134

  Fly   203 GCGRSAMDILWMRLHYALKAAARSHTETQHSP--IPATSSTSSASPTHSPP-----PQMPPRFSA 260
            .......|:..............|..|.:..|  .....:..||.|..|..     |.:....:|
 Frog   135 IVLNDDEDVTSGNDFEGKFIQPESDKERERQPKRSRVQKTDKSAQPKDSDKAQGVHPIVRVLLTA 199

  Fly   261 FRPIAALTQSLPMVPVTTAATPLSYLPSMSMATAPLSTNPMNAAAQ-----------IEAIVSNM 314
            ...|...|:.:|:...|..|.|              ..||..:..:           |:.|.:.:
 Frog   200 HEAIPGATKIIPIEAETPEAEP--------------EINPQTSEQEQVQRKGYQEYAIQQIPTEL 250

  Fly   315 G--ASKQG------HLCIYCGKVYSRKYGLKIHIRTHTGFKPLK--------------------- 350
            .  |::.|      ..|.||.||:..|:.|:.|:|.||..||.|                     
 Frog   251 ATKANRVGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTKEKPYKCSLCSYASAIKANLSVHMRKH 315

  Fly   351 ----------------------------------CKFCLRPFGDPSNLNKHVRLHLQTHPSSSAG 381
                                              |:||.:.:.|..||.||::   :||......
 Frog   316 TGEKFSCDHCTFSCLSKGHLKVHVERVHKKIKQHCRFCKKKYSDVKNLIKHIK---ETHDLLDKK 377

  Fly   382 VADGGASGADMDGDVDIEGETDADYQCHVCHKSFPRRRDLQRHMETRHG 430
            |.:    ..|....:..||:....|.||:|.:.|....:..|||.. ||
 Frog   378 VQE----TFDELRLLTREGKRQLLYDCHICERKFKNELERDRHMLV-HG 421

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 32/174 (18%)
C2H2 Zn finger 323..343 CDD:275368 9/20 (45%)
zf-H2C2_2 336..358 CDD:290200 11/77 (14%)
C2H2 Zn finger 351..371 CDD:275368 8/20 (40%)
zf-C2H2 406..427 CDD:278523 8/21 (38%)
C2H2 Zn finger 408..427 CDD:275368 7/19 (37%)
zfatXP_012820307.1 zf-C2H2 265..287 CDD:278523 9/22 (41%)
C2H2 Zn finger 267..287 CDD:275368 9/20 (45%)
zf-H2C2_2 279..301 CDD:290200 8/22 (36%)
C2H2 Zn finger 295..315 CDD:275368 0/20 (0%)
C2H2 Zn finger 322..343 CDD:275368 0/21 (0%)
C2H2 Zn finger 350..371 CDD:275368 9/24 (38%)
C2H2 Zn finger 400..420 CDD:275368 7/21 (33%)
C2H2 Zn finger 428..448 CDD:275368
C2H2 Zn finger 454..472 CDD:275368
C2H2 Zn finger 714..734 CDD:275368
C2H2 Zn finger 742..792 CDD:275368
COG5048 <761..926 CDD:227381
C2H2 Zn finger 802..821 CDD:275368
C2H2 Zn finger 852..873 CDD:275368
C2H2 Zn finger 881..901 CDD:275368
zf-H2C2_2 893..918 CDD:290200
C2H2 Zn finger 909..929 CDD:275368
C2H2 Zn finger 938..958 CDD:275368
C2H2 Zn finger 966..987 CDD:275368
C2H2 Zn finger 1013..1031 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.