DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and znf507

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_004913609.1 Gene:znf507 XenbaseID:XB-GENE-1032939 Length:911 Species:Xenopus tropicalis

Alignment Length:503 Identity:86/504 (17%)
Similarity:157/504 (31%) Gaps:155/504 (31%)


  Fly    12 QKRSASLIFRIEQLLPSTSIT-PTSMT-TSSTETTLTATTSTASPAKRMRMSNPRPGVYASQYTP 74
            ::|:.|...|:..|.....:| |.|:. ...:...:.:...:..|....:..:.....|:...:.
 Frog   422 RRRTNSECLRLHSLAAEALVTMPISVVECPKSSLRILSKPDSLDPDTGQQEGDRNFATYSKIVSS 486

  Fly    75 K-----DTCSMAIPTSALLGSTVMPTDGSRSHCQLSNG--ELIVSGSLLRQIKLSEDVYSFNAIF 132
            |     |.|          |.||:....|:...:|...  ::.:|.|||:.|:            
 Frog   487 KMPEKVDGC----------GQTVINLKESQEGSELKEAPIKMGISMSLLKVIE------------ 529

  Fly   133 ELHGGQVRVRLVRDVAREDEIVAWFGEELVLLMGIPFLTPLNI-----QGNSRYMCHLCHLTFET 192
                 ::|.|..:: |.:|:|:....:.......:.|.:..|:     .....|.|.|||.:.:.
 Frog   530 -----KLRERTDQN-ATDDDILKELRDNAQTESTVDFASSSNVVEYLPHAERPYRCRLCHYSSDN 588

  Fly   193 PHPLKIHLALG----------CGRSAMDILWMRLH------------------YALKAAARSHTE 229
            ...:|.||.:.          |...|.:...:..|                  :..||..|:| |
 Frog   589 KGYIKQHLRVHRQRQPYQCPICEHIADNSSDLENHMINHCKTRMYECKHCAESFYYKAQLRNH-E 652

  Fly   230 TQHSPIP-----ATSSTSSASPTHSPPPQMPPRFSAFRPIAALTQSLPMVPVTTAATPLSYLPSM 289
            .:|...|     :|||......:.....:.|...|.                             
 Frog   653 REHRSHPDNRTLSTSSDEQHGSSGDNEDKQPSEGSK----------------------------- 688

  Fly   290 SMATAPLSTNPMNAAAQIEAIVSNMGASKQGHLCIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFC 354
                   |.||                  :.:.|..|....|...|::.|.|.||..||.:|:.|
 Frog   689 -------SCNP------------------KLYRCDVCSYTSSTYVGVRNHRRIHTCDKPYRCQVC 728

  Fly   355 LRPFGDPSNLNKHVRLHLQTHPSSSAGVADGGASGADMDGDVDIEGETDADYQCHVCHKSFPRRR 419
            .....:.|:|..|:|.|.:.|.:...                 :|     .|:|.:|........
 Frog   729 NFATTNMSSLKCHMRRHPEEHQAVQL-----------------VE-----QYKCSLCGYVCSHPP 771

  Fly   420 DLQRHMETRHGGHHSHSHSESRS--SSTSTSSTTTMTATVTTSTSKSS 465
            .|:.|| .:|....::::.:...  :...:.|:.....|:..|.|:.|
 Frog   772 SLKSHM-WKHASDQNYNYEQVNKAINEAMSQSSRIQGETIKKSLSEDS 818

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 21/100 (21%)
C2H2 Zn finger 323..343 CDD:275368 6/20 (30%)
zf-H2C2_2 336..358 CDD:290200 8/22 (36%)
C2H2 Zn finger 351..371 CDD:275368 6/20 (30%)
zf-C2H2 406..427 CDD:278523 6/21 (29%)
C2H2 Zn finger 408..427 CDD:275368 5/19 (26%)
znf507XP_004913609.1 C2H2 Zn finger 579..599 CDD:275368 7/20 (35%)
C2H2 Zn finger 607..627 CDD:275368 3/20 (15%)
C2H2 Zn finger 635..655 CDD:275368 5/21 (24%)
C2H2 Zn finger 697..717 CDD:275368 6/20 (30%)
C2H2 Zn finger 725..745 CDD:275368 6/20 (30%)
C2H2 Zn finger 760..780 CDD:275368 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.