DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and znf513a

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001296396.1 Gene:znf513a ZFINID:ZDB-GENE-030131-9895 Length:548 Species:Danio rerio

Alignment Length:342 Identity:75/343 (22%)
Similarity:114/343 (33%) Gaps:108/343 (31%)


  Fly   168 PFLTPL---------NIQ-------GNSRYMCHLCHLTFETPHPLK----IHLALGCGRS-AMDI 211
            |:..||         |:|       |...|.|:.|.....:...||    :|..:|.|:| ...:
Zfish   202 PYGCPLCSYASAQLVNLQRHLRIHTGEKPYKCNTCTFACSSLGNLKRHQRMHATIGPGQSVTQPV 266

  Fly   212 LWMRLHYALKAAARSHTETQHSPIPATSSTSSASPTH---------------------------- 248
            ....|:::  .||:...|...:|.....:..|.:..|                            
Zfish   267 SGNGLNHS--TAAQKEKEAVPAPTEVAGAVRSVTRPHMGRDGNYLQTFDGLRLAQQTSTGVLQSG 329

  Fly   249 ---SPPPQMPPRFSAF----------------RPIAALTQSLPMVPVTTAATPLSYLPSM-SMAT 293
               |.|..:||.|..|                ..|.|.. :|.|:...|...|......: :.|.
Zfish   330 QAASQPAALPPMFFPFTCRLCGMALDDEDGSSAQICAKC-TLEMLTKDTHGCPAERGDKVYTCAA 393

  Fly   294 APLSTN-PMNAAAQIEAIVSNMGASKQGHLCIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRP 357
            .|..|: |.:.|..::.     .:.::.:.|..|....:....||.|.|.|||.||.||..|...
Zfish   394 CPFLTHYPNHLARHMKT-----HSGEKPYKCPQCDYASAHFDNLKRHHRVHTGEKPYKCHLCDYA 453

  Fly   358 FGDPSNLNKHVRLHLQTHPSSSAGVADGGASGADMDGDVDIEGETDADYQCHVCHKSFPRRRDLQ 422
            .|:.:||.:|.|:|                |||             ..:||.:|:.|..:..:|:
Zfish   454 CGNLANLKRHQRVH----------------SGA-------------KPFQCAICNYSCNQSMNLK 489

  Fly   423 RHMETRHGGHHSHSHSE 439
            ||| .||.|...|...|
Zfish   490 RHM-LRHTGEKPHKCQE 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 26/102 (25%)
C2H2 Zn finger 323..343 CDD:275368 6/20 (30%)
zf-H2C2_2 336..358 CDD:290200 12/22 (55%)
C2H2 Zn finger 351..371 CDD:275368 7/20 (35%)
zf-C2H2 406..427 CDD:278523 8/21 (38%)
C2H2 Zn finger 408..427 CDD:275368 7/19 (37%)
znf513aNP_001296396.1 C2H2 Zn finger 177..197 CDD:275368
zf-H2C2_2 189..214 CDD:290200 3/12 (25%)
COG5048 201..>503 CDD:227381 74/339 (22%)
C2H2 Zn finger 205..225 CDD:275368 4/20 (20%)
zf-H2C2_2 217..242 CDD:290200 6/25 (24%)
C2H2 Zn finger 233..253 CDD:275368 4/20 (20%)
C2H2 Zn finger 391..411 CDD:275368 5/25 (20%)
zf-H2C2_2 403..428 CDD:290200 3/30 (10%)
C2H2 Zn finger 419..439 CDD:275368 6/20 (30%)
zf-H2C2_2 431..454 CDD:290200 12/23 (52%)
C2H2 Zn finger 447..467 CDD:275368 7/20 (35%)
zf-H2C2_2 459..484 CDD:290200 12/54 (22%)
C2H2 Zn finger 475..495 CDD:275368 8/21 (38%)
zf-H2C2_2 487..510 CDD:290200 9/21 (43%)
C2H2 Zn finger 503..523 CDD:275368 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.