DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and zbtb21

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_695193.6 Gene:zbtb21 ZFINID:ZDB-GENE-050411-7 Length:1061 Species:Danio rerio

Alignment Length:534 Identity:107/535 (20%)
Similarity:173/535 (32%) Gaps:187/535 (35%)


  Fly    12 QKRSASL---IFR----------IEQLLPSTSITPTSMTTSSTETTLTATTST---------ASP 54
            |::|.||   :|:          .:|...|..:.|....|:||.::..:.::|         :||
Zfish   202 QRKSLSLQGKLFKQVTEHPAHSFSDQSQSSGQVKPNEKETNSTSSSRHSNSNTVDGSCGSIISSP 266

  Fly    55 AKRM-RMSNPRPGVYASQYTPKDTCSMAIPTSALLGSTV-------MPT----------DGSRSH 101
            ...: |.:..||.....|.|...:.|.::..::|.....       |.|          .|.||.
Zfish   267 TSILRRRTEYRPPCMRPQLTSSVSFSESVQHASLQSDQADGAIDGGMETLHDSKPVGEHQGLRSQ 331

  Fly   102 CQLSNGELIVSGSLLRQIKLSEDVYSFNAIFELHGGQVR----VRLVRDVARE--DEIVAWFGEE 160
            ....:|.||.| .|.|.:.:...|.:|:...||...|.|    |:|:..:||.  .|:|....::
Zfish   332 TVDRSGPLIKS-LLRRSLSMDSPVPAFSPALELKDSQSREQSVVKLMPTLARSPPPELVDQVSKD 395

  Fly   161 LVLLMGIPFLTPLNIQGNSRYMCHLCHLTFETPHPLKIHLALGCGRSAMDILWMRLHYALKAAAR 225
            :.||:            .||             ||:   ::.|                      
Zfish   396 MPLLL------------RSR-------------HPI---MSEG---------------------- 410

  Fly   226 SHTETQHSPIPATSSTSSASPTH----SPPPQMPPRFSAFR------PIAALTQSLPMVPVTTAA 280
              |:|....|.|..|:..|.|:.    :....:|..|..|:      |....|.|:.    ..:.
Zfish   411 --TQTNQHRIKAEPSSPLADPSEIVRITVGDNLPVNFKDFQANYDEGPRGYFTASVK----RKSK 469

  Fly   281 TPLSYLP---------------SMSMATAPLSTNPMNAAAQIEAIVSNMGASKQGHL--CIYCGK 328
            ...||:|               ..::..||.::|       |::.....|..:...:  |..|.|
Zfish   470 MDGSYMPFKRSRPVNEHHLLHQETTLDEAPYNSN-------IDSCTEEPGELRPNKMFKCWNCLK 527

  Fly   329 VYSRKYGLKIHIRT-HTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHPSSSAGV----ADGGAS 388
            |:....||..|:.. |...||..|..|.:.|        |....:.||..:..||    |...:|
Zfish   528 VFRSNAGLYRHVNMYHNPEKPYACDICHKRF--------HTNFKVWTHCQTQHGVVQNPAPSSSS 584

  Fly   389 GADMDGD-----VDIEGETD----------------------------ADYQCHVCHKSFPRRRD 420
            .:.:|..     :||..|.:                            ..|.|..|.|.|..:..
Zfish   585 YSVLDEKFQRKLIDIVREREIKKALIMKLRRTKQGLQSQTFGRKSRRSRSYGCPFCGKMFFFQSH 649

  Fly   421 LQRHMETRHGGHHS 434
            |:.||:    ||.|
Zfish   650 LKLHMK----GHSS 659

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 24/118 (20%)
C2H2 Zn finger 323..343 CDD:275368 7/21 (33%)
zf-H2C2_2 336..358 CDD:290200 7/23 (30%)
C2H2 Zn finger 351..371 CDD:275368 4/20 (20%)
zf-C2H2 406..427 CDD:278523 8/21 (38%)
C2H2 Zn finger 408..427 CDD:275368 7/19 (37%)
zbtb21XP_695193.6 BTB 58..156 CDD:279045
BTB 69..154 CDD:197585
C2H2 Zn finger 522..543 CDD:275368 7/21 (33%)
C2H2 Zn finger 637..657 CDD:275368 8/24 (33%)
C2H2 Zn finger 693..712 CDD:275368
C2H2 Zn finger 874..894 CDD:275368
C2H2 Zn finger 902..922 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.