DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and CG8388

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_611075.1 Gene:CG8388 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster

Alignment Length:376 Identity:77/377 (20%)
Similarity:118/377 (31%) Gaps:140/377 (37%)


  Fly   175 IQGNSRYMCHLCHLTFETPHPLKIHL---------ALGCGRSAMD----ILWMRLHY-------- 218
            |:.:.:..||:|:|..|....:..|:         |:.|.|..:.    :..:|.|.        
  Fly   226 IREHYKVQCHICNLPMEDFSEMLAHVRREHKQRGYAMCCNRKFLKRGVLVDHLRRHQDPETFKCS 290

  Fly   219 ----------ALKAAARSHTETQHSPIPATSSTSSA----------SPTHSPPPQMPPRFSAFRP 263
                      :|:...|.|.......:......|.|          ..||.|..|.         
  Fly   291 ICGRVMGHRRSLELHMRMHEIKSRGRLYRCEQCSKAFYSAVVYERHKLTHIPREQW--------- 346

  Fly   264 IAALTQSLPMVPVTTAATPLSYLPSMSMATAPLSTNPMNAAAQI-----------EAIVSNM--- 314
                     .||.|....  :| ||.......:....:|..|:|           ||:..:|   
  Fly   347 ---------KVPCTHCEK--TY-PSQYTMQQHVKLVHLNLYAKICDVCGKSIRGREALARHMEEH 399

  Fly   315 -GASKQGHLCIYCGKVYSRKYGLKIHIR-THT--GFKPLKCKFCLR--PFGDPSNLNKHVRLHLQ 373
             |..:....|..|..:.:.||||..||: .||  ..:|::|:|||:  |     :|..|......
  Fly   400 TGGPQAAIKCHLCDSMLTTKYGLARHIKMMHTAENLQPMQCEFCLKICP-----SLQAHQHHIKY 459

  Fly   374 THPSSSAGVADGGASGADMDGDVDIEGETDADYQCHVCHKSFPRRRDLQRHMETRHG-------- 430
            ||                         .|...:||.:|.|:|.|..:|:.||.|..|        
  Fly   460 TH-------------------------NTARSHQCPMCEKAFKRPNELKEHMTTHTGEVLYTCPH 499

  Fly   431 -------GHHSHSH---------SESRSS--STSTSSTTTMTATV--TTST 461
                   ..:.|:|         .|:|..  :.|..|.|.:..:|  ||.|
  Fly   500 CPQTFNSNANMHAHRKKVHRKEWEENRHKRLNRSRKSDTIIAVSVRKTTET 550

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 30/120 (25%)
C2H2 Zn finger 323..343 CDD:275368 8/21 (38%)
zf-H2C2_2 336..358 CDD:290200 11/27 (41%)
C2H2 Zn finger 351..371 CDD:275368 7/22 (32%)
zf-C2H2 406..427 CDD:278523 9/21 (43%)
C2H2 Zn finger 408..427 CDD:275368 8/19 (42%)
CG8388NP_611075.1 zf-AD <21..77 CDD:285071
C2H2 Zn finger 264..281 CDD:275368 3/17 (18%)
C2H2 Zn finger 289..309 CDD:275368 2/20 (10%)
C2H2 Zn finger 320..340 CDD:275368 3/20 (15%)
C2H2 Zn finger 350..369 CDD:275368 4/22 (18%)
C2H2 Zn finger 440..461 CDD:275368 8/26 (31%)
C2H2 Zn finger 469..489 CDD:275368 9/20 (45%)
C2H2 Zn finger 497..515 CDD:275368 2/18 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24403
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.