DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and rgr

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001163089.2 Gene:rgr FlyBaseID:FBgn0267792 Length:889 Species:Drosophila melanogaster

Alignment Length:178 Identity:43/179 (24%)
Similarity:64/179 (36%) Gaps:26/179 (15%)


  Fly   297 STNPMNAAAQIEAIVSNMGASKQGHLCIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDP 361
            |:.|:..|...|.:..|:|..:    |..|..:.......|:|...|.|.:|..|..|.:.|..|
  Fly   669 SSIPLLHAKLAEFLDQNLGPFR----CDICSDLVKTCDQYKVHRSAHDGTQPFICTLCGKGFQMP 729

  Fly   362 SNLNKHVRLHLQTHPSSSAGVADGGASGADMDGDVDIEGET-DADYQCHVCHKSFP--------R 417
            .||..|:|.|.:..|.|........|:..::  .:.:...| :..|.|.:|.|||.        |
  Fly   730 CNLTVHIRRHRRDFPYSCEQCDKRFATSTEV--AIHLRTHTGERPYICDLCGKSFKTWSFFDIHR 792

  Fly   418 RRDLQR-----------HMETRHGGHHSHSHSESRSSSTSTSSTTTMT 454
            ||.|.:           ..|......|.:||...|....:....|..|
  Fly   793 RRHLNQSTFHCPICAKGFYEKNRFTDHMNSHWAIRKHLCTVCGKTFTT 840

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 24/83 (29%)
C2H2 Zn finger 323..343 CDD:275368 4/20 (20%)
zf-H2C2_2 336..358 CDD:290200 7/22 (32%)
C2H2 Zn finger 351..371 CDD:275368 8/20 (40%)
zf-C2H2 406..427 CDD:278523 11/40 (28%)
C2H2 Zn finger 408..427 CDD:275368 10/38 (26%)
rgrNP_001163089.2 MADF_DNA_bdg 335..420 CDD:287510
MADF_DNA_bdg 465..551 CDD:287510
MADF_DNA_bdg 595..682 CDD:287510 4/13 (31%)
C2H2 Zn finger 691..711 CDD:275368 4/20 (20%)
C2H2 Zn finger 719..739 CDD:275368 8/20 (40%)
zf-H2C2_2 731..756 CDD:290200 8/25 (32%)
COG5048 742..>824 CDD:227381 18/84 (21%)
C2H2 Zn finger 747..767 CDD:275368 1/22 (5%)
zf-H2C2_2 763..784 CDD:290200 7/21 (33%)
C2H2 Zn finger 775..795 CDD:275368 8/20 (40%)
C2H2 Zn finger 803..818 CDD:275368 1/15 (7%)
C2H2 Zn finger 831..851 CDD:275368 2/11 (18%)
C2H2 Zn finger 859..877 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24403
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.