DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and CG10366

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_609995.1 Gene:CG10366 FlyBaseID:FBgn0032814 Length:578 Species:Drosophila melanogaster

Alignment Length:266 Identity:63/267 (24%)
Similarity:94/267 (35%) Gaps:77/267 (29%)


  Fly   180 RYMCHLCHLTFETPHPLKIHLALGCGRSAMDILWM---------RLHYALKAAARSHTETQHSPI 235
            |:.|:.|..::.|...|:.||....|::......:         ||||.|:...:.|.     |:
  Fly   239 RHQCNECLRSYATSKTLQRHLRQDHGQTEPTTEQLQCPDCPKKFRLHYQLERHMKWHV-----PL 298

  Fly   236 P-----ATSS------TSSASPTHSPPPQMPPRFSAFRPI------------AALTQSL----PM 273
            |     |.||      ||:::..|.....:..|   .||:            :||.:.:    ..
  Fly   299 PKRKQYACSSCDKKFATSASAQQHEQYMHLDER---PRPVICEQCGVGVHSMSALKEHVLKHTDY 360

  Fly   274 VPVTTAA------------------TPLSYL-PSMSMATAPLSTNPMNAAAQIEAIVSNMGASKQ 319
            .|.....                  .|..|: |...|.....:|  :|....:.       ..:.
  Fly   361 APFECEVCKKCFKSANRLKHHKETHDPHKYICPECGMQLNSRTT--LNRHRLVH-------TDQM 416

  Fly   320 GHLCIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHPSSSAG--V 382
            .|.|.|||:.:.|...||.|:..|||.||..|.||.|.|.:.||...|.:   ::||...|.  .
  Fly   417 QHKCDYCGREFKRAKALKNHLILHTGLKPYSCDFCDRTFANGSNCRTHKK---KSHPEELAAQEA 478

  Fly   383 ADGGAS 388
            |.||.|
  Fly   479 AGGGRS 484

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 30/119 (25%)
C2H2 Zn finger 323..343 CDD:275368 8/20 (40%)
zf-H2C2_2 336..358 CDD:290200 12/22 (55%)
C2H2 Zn finger 351..371 CDD:275368 8/20 (40%)
zf-C2H2 406..427 CDD:278523
C2H2 Zn finger 408..427 CDD:275368
CG10366NP_609995.1 zf-AD 28..108 CDD:285071
PTZ00423 131..>230 CDD:240413
COG5048 <222..408 CDD:227381 34/179 (19%)
C2H2 Zn finger 242..263 CDD:275368 6/21 (29%)
C2H2 Zn finger 275..295 CDD:275368 5/20 (25%)
C2H2 Zn finger 306..357 CDD:275368 10/54 (19%)
C2H2 Zn finger 365..385 CDD:275368 0/20 (0%)
C2H2 Zn finger 392..412 CDD:275368 4/22 (18%)
zf-C2H2 418..440 CDD:278523 9/22 (41%)
C2H2 Zn finger 420..440 CDD:275368 8/20 (40%)
zf-H2C2_2 432..457 CDD:290200 13/25 (52%)
C2H2 Zn finger 448..466 CDD:275368 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24403
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.