DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and Zfp335

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_017174546.1 Gene:Zfp335 MGIID:2682313 Length:1373 Species:Mus musculus

Alignment Length:506 Identity:103/507 (20%)
Similarity:162/507 (32%) Gaps:177/507 (35%)


  Fly     3 TTAQLDSLEQKRSASLIFRIEQLLPSTSITPTSMTTSSTETTLTATTSTASP------AKRMRMS 61
            |...||.|       |....::.|.:|::....:.:...|..||:|....||      ...:.|:
Mouse   793 TQTALDLL-------LNMSAQRELGATALQVAVVKSEGIEAELTSTGGQPSPEDTTPRVVTLHMA 850

  Fly    62 NPRPGVYA-SQYTPKDTCSMAIPTSALLGS-----TVMPTDGSRSHCQLSNGELIVSGSLLRQIK 120
            .....|.| ||..|.|...:|:|:....|:     |..|.:|..|          .||...|:  
Mouse   851 ESGSSVAAESQLGPSDLQQIALPSGPFGGASYSVITAPPVEGRTS----------ASGPPYRE-- 903

  Fly   121 LSEDVYSFNAIFELHGGQVRVRLVRDVARE---DEIVAWFGE-----ELVLLMGIPFLTPLNIQG 177
                        |..|...:..:|.|..:|   ..|:|..|.     ||.....|.|.:|..:..
Mouse   904 ------------EPPGEAAQAVVVSDTLKEAGTHYIMAADGTQLHHIELTADGSISFPSPDTLAP 956

  Fly   178 NSRYMCHLCHLTFETPHPLKIHLALGCG---RSAMDILWMRLHYALKAAARSHTETQHSPIPATS 239
            .:::             ||     |.||   |...::|             |.|:|.|......|
Mouse   957 GTKW-------------PL-----LQCGGPPRDGSEVL-------------SPTKTHHMGGSQGS 990

  Fly   240 STSSASPTHSPPPQMPPRFSAFRPIAALTQSLPMVPVTTAATPLSYLPSMSMATAPLSTNPMNAA 304
            ||        |||             |.:.:|.:|           :|....:.|..||...:..
Mouse   991 ST--------PPP-------------AASHTLGLV-----------VPQSPPSAAASSTKKFSCK 1023

  Fly   305 AQIEAIVS--NMGASKQGHL---------CIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPF 358
            ...||..|  .|.:.|:.|.         |.:..:.:..   ::.|:..|:..:|.:|..|    
Mouse  1024 VCSEAFPSRAEMESHKRAHAGPAAFKCPDCPFSARQWPE---VRAHMAQHSSLRPHQCNQC---- 1081

  Fly   359 GDPSNLNKHVRLHLQTHPSSSAGVADGGASGADMDGDVDIEGETDADYQCHVCHKSFPRRRDLQR 423
            ...|...|.:|.|:.||.:                         :..:.||||.:.|.|...|:.
Mouse  1082 SFASKNKKDLRRHMLTHTN-------------------------EKPFSCHVCGQRFNRNGHLKF 1121

  Fly   424 HMETRHGGHHSHSHSESRSSSTSTSSTTTMT----------ATVTTSTSKS 464
            |::..|.       .:.|.:.|||:.....|          ||:.|:...|
Mouse  1122 HIQRLHS-------IDGRKTGTSTARAPAQTIILNSEEETLATLHTAFQSS 1165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 22/111 (20%)
C2H2 Zn finger 323..343 CDD:275368 2/20 (10%)
zf-H2C2_2 336..358 CDD:290200 5/22 (23%)
C2H2 Zn finger 351..371 CDD:275368 5/20 (25%)
zf-C2H2 406..427 CDD:278523 8/21 (38%)
C2H2 Zn finger 408..427 CDD:275368 8/19 (42%)
Zfp335XP_017174546.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.