DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and Zfp142

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_008765462.1 Gene:Zfp142 RGDID:1309648 Length:1841 Species:Rattus norvegicus

Alignment Length:529 Identity:109/530 (21%)
Similarity:148/530 (28%) Gaps:193/530 (36%)


  Fly    25 LLPSTSITPTSMTTSSTETTLTATTSTASPAKRMRMSNPRPGVYASQYTPKDTCSMAIPTSALLG 89
            |.|.|:..|.::......     ...|||||     |.|||.:....      |......|..|.
  Rat  1298 LCPFTAPAPAALRLHQKR-----RHPTASPA-----SGPRPLLQCGD------CGFTCKQSRCLQ 1346

  Fly    90 S-TVMPTDGSRSH----CQLSNGELIVSGSLLRQIKLS-----------------EDVYSFNAIF 132
            . ..:..:|.:.|    |..|.         .|:.:|.                 ...:..|:..
  Rat  1347 QHRRLKHEGVKPHQCPFCDFST---------TRRYRLEAHQSRHTGVGRIPCSSCPQTFGTNSKL 1402

  Fly   133 ELHGGQVRVR----------------LVRDVAREDEIVAWFGEELVLLMGIPFLTPLNI--QGNS 179
            .||  |:||.                |..|:.|.                      :|.  ||..
  Rat  1403 RLH--QLRVHDKTPTHFCPLCDYSGYLRHDITRH----------------------VNSCHQGTP 1443

  Fly   180 RYMCHLCHLTFETPHPLKIHL---------ALGCGRSAMDILWMRLHYA-------LKAAARSHT 228
            .:.|..|...|.:...||.|.         :.||   .:|:....||.:       ..|:.|.||
  Rat  1444 SFSCSQCEAQFSSETALKQHALRRHPEPTPSSGC---PVDVTEGPLHCSHCGLLCPSPASLRGHT 1505

  Fly   229 ETQHSPIPATSSTSS-----ASPTHSPPPQMPPR-----FSAFRPIAALTQSLPMVPVTTAATPL 283
            ..||..:...:...|     |...|........|     |:|...:..:...|.....|:.|   
  Rat  1506 RKQHPRLECGACQESFPSRPALDEHRRQHHFSHRCQLCSFAARERVGLVKHYLEQHEETSTA--- 1567

  Fly   284 SYLPSMSMATAPLSTNPMNAAAQIEAIVSNMGASKQG----HLCIYCGKVYSRKYGLKI--HIRT 342
               ||...|..|....|....|....:|.:......|    :.|..|  .||.|...||  |.|.
  Rat  1568 ---PSDGDAGQPSLCCPFCDFACRHQLVLDHHVKGHGGTRLYKCTDC--AYSTKNRQKITWHSRI 1627

  Fly   343 HTGFKPLKCKFCLRPFGDPSNLNKHVRLH--------------------LQTHPSSSAGVADGGA 387
            |||.||.:|..|.....|||.|..|:|:|                    |:.|.:...|:     
  Rat  1628 HTGEKPYRCHLCSYACADPSRLKYHMRIHKEERKYLCPECGYKCKWVNQLKYHMTKHTGL----- 1687

  Fly   388 SGADMDGDVDIEGETDADYQCHVCHKSFPRRRDLQRHMETRHG--------------------GH 432
                            ..|||..|.....|...|:.|.||||.                    ..
  Rat  1688 ----------------KPYQCPECEYCTNRADALRVHRETRHKEARAFMCEQCGKAFKTRFLLRT 1736

  Fly   433 HSHSHSESR 441
            |...|||::
  Rat  1737 HLRKHSEAK 1745

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 34/126 (27%)
C2H2 Zn finger 323..343 CDD:275368 9/22 (41%)
zf-H2C2_2 336..358 CDD:290200 11/24 (46%)
C2H2 Zn finger 351..371 CDD:275368 8/20 (40%)
zf-C2H2 406..427 CDD:278523 8/21 (38%)
C2H2 Zn finger 408..427 CDD:275368 6/19 (32%)
Zfp142XP_008765462.1 COG5048 321..762 CDD:227381
C2H2 Zn finger 346..366 CDD:275368
C2H2 Zn finger 374..394 CDD:275368
C2H2 Zn finger 402..419 CDD:275368
C2H2 Zn finger 436..456 CDD:275368
C2H2 Zn finger 502..521 CDD:275368
C2H2 Zn finger 526..547 CDD:275368
C2H2 Zn finger 555..576 CDD:275368
C2H2 Zn finger 584..604 CDD:275368
C2H2 Zn finger 612..632 CDD:275368
C2H2 Zn finger 640..660 CDD:275368
C2H2 Zn finger 668..688 CDD:275368
C2H2 Zn finger 695..712 CDD:275368
C2H2 Zn finger 1266..1295 CDD:275368
C2H2 Zn finger 1332..1353 CDD:275368 3/27 (11%)
C2H2 Zn finger 1361..1381 CDD:275368 4/29 (14%)
C2H2 Zn finger 1389..1410 CDD:275368 6/23 (26%)
C2H2 Zn finger 1447..1468 CDD:275368 6/21 (29%)
C2H2 Zn finger 1488..1506 CDD:275368 4/18 (22%)
C2H2 Zn finger 1514..1534 CDD:275368 3/20 (15%)
C2H2 Zn finger 1580..1600 CDD:275368 3/20 (15%)
C2H2 Zn finger 1608..1628 CDD:275368 9/22 (41%)
C2H2 Zn finger 1636..1656 CDD:275368 8/20 (40%)
C2H2 Zn finger 1664..1684 CDD:275368 2/20 (10%)
C2H2 Zn finger 1692..1713 CDD:275368 8/21 (38%)
C2H2 Zn finger 1721..1741 CDD:275368 1/20 (5%)
C2H2 Zn finger 1749..1769 CDD:275368
C2H2 Zn finger 1777..1797 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.