DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and sov

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001284962.1 Gene:sov FlyBaseID:FBgn0286831 Length:3313 Species:Drosophila melanogaster

Alignment Length:282 Identity:57/283 (20%)
Similarity:88/283 (31%) Gaps:93/283 (33%)


  Fly   172 PLNIQGN-SRYMCHLCHLTFETPHPLKIHLALGCGRSAMDILWMRLH-----YA------LKAAA 224
            |..::.| :|:.|                :|..|...|..:::||.|     |:      |..|.
  Fly  2200 PAAVEENRNRFRC----------------MATNCNFVAHKLMFMREHMKFHSYSFSSTGHLNCAY 2248

  Fly   225 RSHTETQ-----------HSPIPATSSTSSASPTHSPPPQMPPRFSAFRPIAALTQSLPMVPVTT 278
            .||....           |...|.:...||..|        |......|.:.:..:: ..||..|
  Fly  2249 CSHVAVDVDDYLRHGVIIHDLAPRSELESSTGP--------PSVTQKIRDMLSQREN-GRVPPPT 2304

  Fly   279 AATPLSYLPSMSMATAPLSTNPMNAAAQIEAIVSNMGASKQGHLCIYCGKVYSRKYGLKIHIR-T 342
            ....||.:....:.....|.:.:.|..|...||.........|              |:.||| |
  Fly  2305 PQVTLSDVVLGLLECTGYSEDKLYACPQKGCIVRLTDEQLVNH--------------LRYHIRST 2355

  Fly   343 HTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHPSSSAGVADGGASGADMDGDVDIEGETDADYQ 407
            |.|.:.:|||||.:....|:     :|.|||.:.:..:                         ..
  Fly  2356 HQGSELVKCKFCTKAMHPPA-----LRTHLQQYHARHS-------------------------IF 2390

  Fly   408 CHVCHKSFPRRRDLQRHMETRH 429
            |.:|..:...:|.:..||.|.|
  Fly  2391 CGICLATSVNQRIMMYHMSTVH 2412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 25/101 (25%)
C2H2 Zn finger 323..343 CDD:275368 5/21 (24%)
zf-H2C2_2 336..358 CDD:290200 12/23 (52%)
C2H2 Zn finger 351..371 CDD:275368 6/20 (30%)
zf-C2H2 406..427 CDD:278523 5/21 (24%)
C2H2 Zn finger 408..427 CDD:275368 5/19 (26%)
sovNP_001284962.1 TonB_N 2032..>2077 CDD:292650
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24403
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.