DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and Zfp513

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001012110.1 Gene:Zfp513 RGDID:1310456 Length:541 Species:Rattus norvegicus

Alignment Length:356 Identity:73/357 (20%)
Similarity:103/357 (29%) Gaps:142/357 (40%)


  Fly   181 YMCHLCHLTFETPHPLKIHL-------ALGCGR---SAMDILWMRLHYALKAAARSHT-----ET 230
            |.|.||.........||.|:       ...|||   ::..::.:..|      .|:||     ..
  Rat   150 YSCRLCAFVSHYSSHLKRHMQTHSGEKPFRCGRCPYASAQLVNLTRH------TRTHTGEKPYRC 208

  Fly   231 QHSPIPATS--STSSASPTHSPPPQMPPRFSAFRPIAALTQSLPMVPVTTAAT------PLSYLP 287
            .|.|...:|  :......||:.||..|.....|| ..|...:.|..|.....|      ....||
  Rat   209 PHCPFACSSLGNLRRHQRTHTGPPTPPCPTCGFR-CCAPRPTRPPSPTEQEGTMPRRSEDALILP 272

  Fly   288 SMSMATAPLSTNPMNAAAQI--------------------------------EAIVSNMGASKQG 320
            .:|:...|..|:.:....|:                                |...|.:|.:..|
  Rat   273 DLSLHVPPGGTSFLPDCGQLRGEGEGLCGTGSEPLPELLFPWTCRGCGQELEEGEGSRLGTAMCG 337

  Fly   321 ------------------------------------HL--------------CIYCGKVYSRKYG 335
                                                ||              |..|....:....
  Rat   338 RCMRGESGGGGSGGPQGPSDKGFACSLCPFATHYPNHLARHMKTHSGEKPFRCARCPYASAHLDN 402

  Fly   336 LKIHIRTHTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHPSSSAGVADGGASGADMDGDVDIEG 400
            ||.|.|.|||.||.||..|....|:.:||.:|.|:|                ||           
  Rat   403 LKRHQRVHTGEKPYKCPLCPYACGNLANLKRHGRIH----------------SG----------- 440

  Fly   401 ETDADYQCHVCHKSFPRRRDLQRHMETRHGG 431
              |..::|.:|:.|..:..:|:||| .||.|
  Rat   441 --DKPFRCSLCNYSCNQSMNLKRHM-LRHTG 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 33/188 (18%)
C2H2 Zn finger 323..343 CDD:275368 6/20 (30%)
zf-H2C2_2 336..358 CDD:290200 12/22 (55%)
C2H2 Zn finger 351..371 CDD:275368 7/20 (35%)
zf-C2H2 406..427 CDD:278523 7/21 (33%)
C2H2 Zn finger 408..427 CDD:275368 7/19 (37%)
Zfp513NP_001012110.1 C2H2 Zn finger 152..172 CDD:275368 6/20 (30%)
zf-H2C2_2 164..189 CDD:290200 6/25 (24%)
COG5048 176..>228 CDD:227381 11/58 (19%)
C2H2 Zn finger 180..200 CDD:275368 5/26 (19%)
zf-H2C2_2 192..217 CDD:290200 6/31 (19%)
C2H2 Zn finger 208..228 CDD:275368 4/20 (20%)
C2H2 Zn finger 362..382 CDD:275368 2/20 (10%)
COG5048 <372..>450 CDD:227381 27/107 (25%)
zf-H2C2_2 374..399 CDD:290200 4/25 (16%)
C2H2 Zn finger 390..410 CDD:275368 6/20 (30%)
zf-H2C2_2 402..425 CDD:290200 12/23 (52%)
COG5048 414..>487 CDD:227381 24/86 (28%)
C2H2 Zn finger 418..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 446..466 CDD:275368 8/21 (38%)
zf-H2C2_2 458..481 CDD:290200 7/13 (54%)
C2H2 Zn finger 474..493 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.