DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and Pogz

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_008759517.1 Gene:Pogz RGDID:1309980 Length:1410 Species:Rattus norvegicus

Alignment Length:458 Identity:99/459 (22%)
Similarity:162/459 (35%) Gaps:104/459 (23%)


  Fly    29 TSITPTSMTTSST-------ETTLTATTST----ASPAKRMRMSNPRPGVYASQYTPKDTCSMAI 82
            |::.|.::|..||       :|..|.:|||    ..|....:::...||.......||...|...
  Rat   228 TTVIPATLTIRSTVPQSQSQQTKSTPSTSTTPIATQPTALGQLAGQPPGQPNQTSNPKLAPSFPS 292

  Fly    83 PTSALLGSTVM----PTDGSRSHCQLSNGELIVSGSLLRQIKLSEDVYSFNAIFELHGGQVRVRL 143
            |.:..:.|.|.    ...|..|:                  ::::.|.:.|.|..|  ||....:
  Rat   293 PPAVSIASFVTVKRPGVTGENSN------------------EVAKLVNTLNTIPSL--GQSPGPV 337

  Fly   144 VRDVAREDEIVAWFGEE--LVLLMGIPFLTPLNIQGNSRYMCHLCHLTFETPHPLKIHLALGC-- 204
            |  |:.........|.|  :.:...||.   .::|...|.:|..|:..|.....|:.|:...|  
  Rat   338 V--VSNNSSAQRTSGPESSMKVTSSIPV---FDLQDGGRKICPRCNAQFRVTEALRGHMCYCCPE 397

  Fly   205 -------GRSAMDILWMRLHYALKAAARSHTETQHSPIPATSSTSSASPTHSPPPQMP-PRFSAF 261
                   |:|      :....::.:||:..:..:.:|:.:|.| |:..|..|||.::| |..||.
  Rat   398 MVEYQKKGKS------LDAEPSVPSAAKPASPEKTAPVTSTPS-STPIPALSPPTKVPEPSESAG 455

  Fly   262 RPI-------------------AALTQSLPMVPVTTAATPLSYLPSMSMATAPLSTNP--MN-AA 304
            ..:                   ||...|.|.| .|:...|        ..|..|..|.  || ..
  Rat   456 DTVQTKLIMLVDDFYYGRDGGKAAQLTSFPKV-ATSFRCP--------HCTKRLKNNIRFMNHMK 511

  Fly   305 AQIEAIVSNMGASKQGH-LCIYCGKVYSRKYGLKIHI-RTHTGFK-PLKCKFCLRPFGDPSNLNK 366
            ..:|  :........|| :|.:|.:.:|..:.|:.|: ..|:.:: ..|||.|...|.......:
  Rat   512 HHVE--LDQQNGEVDGHTICQHCYRQFSTPFQLQCHLENVHSPYESTTKCKICEWAFESEPLFLQ 574

  Fly   367 HVRLHLQTH-PSSSAGVADGGASGADMDGDVDIE----GETDADYQCHVCHKSFPRRRDLQRHME 426
            |::   .|| |.....|.......:.:..:||:.    .|......|..|.|.|......|:|. 
  Rat   575 HMK---DTHKPGEMPYVCQVCQYRSSLYSEVDVHFRMIHEDTRHLLCPYCLKVFKNGNAFQQHY- 635

  Fly   427 TRH 429
            .||
  Rat   636 MRH 638

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 24/107 (22%)
C2H2 Zn finger 323..343 CDD:275368 5/21 (24%)
zf-H2C2_2 336..358 CDD:290200 7/24 (29%)
C2H2 Zn finger 351..371 CDD:275368 5/20 (25%)
zf-C2H2 406..427 CDD:278523 6/21 (29%)
C2H2 Zn finger 408..427 CDD:275368 6/19 (32%)
PogzXP_008759517.1 C2H2 Zn finger 493..526 CDD:275371 8/43 (19%)
C2H2 Zn finger 529..550 CDD:275368 5/21 (24%)
C2H2 Zn finger 559..580 CDD:275368 6/24 (25%)
C2H2 Zn finger 589..610 CDD:275368 2/21 (10%)
C2H2 Zn finger 618..638 CDD:275368 7/21 (33%)
CENPB 1018..1079 CDD:197828
rve 1153..>1277 CDD:304425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.