DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and Zfp335

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_008760782.1 Gene:Zfp335 RGDID:628751 Length:1379 Species:Rattus norvegicus

Alignment Length:468 Identity:94/469 (20%)
Similarity:142/469 (30%) Gaps:181/469 (39%)


  Fly    22 IEQLLPSTSITPTSMTTSSTETTLTATTSTASPAKRMRMSNPRPGVYASQYTPKDTCSMAIPTSA 86
            :|..|.||:..|:|..|:....||....|.:|.|..            ||..|.|...:|:|...
  Rat   823 VEAELTSTARQPSSEDTTPRVVTLHVAESGSSVAAE------------SQLGPSDLQQIALPPGP 875

  Fly    87 LLGS-----TVMPTDGSRSHCQLSNGELIVSGSLLRQIKLSEDVYSFNAIFELHGGQVRVRLVRD 146
            ..|:     |..|.:|..|          .||...|:              |..|...:..:|.|
  Rat   876 FSGASYSVITAPPVEGRAS----------ASGPPYRE--------------EPPGEAAQAVVVND 916

  Fly   147 VARE---DEIVAWFGE-----ELVLLMGIPFLTPLNIQGNSRYMCHLCHLTFETPHPLKIHLALG 203
            ..:|   ..|:|..|.     ||.....|.|.:|..:...:::             ||     |.
  Rat   917 TLKEAGTHYIMAADGTQLHHIELTADGSISFPSPDTLAPGTKW-------------PL-----LQ 963

  Fly   204 CG---RSAMDILWMRLHYALKAAARSHTETQH--------SPIPATSSTSSASPTHSPPPQMPPR 257
            ||   |...::|             |.|:|.|        :|.||||........||||      
  Rat   964 CGGPPRDGPEVL-------------SPTKTHHTGGSQGSSTPPPATSHALGLLVPHSPP------ 1009

  Fly   258 FSAFRPIAALTQSLPMVPVTTAATPLSYLPSMSMATAPLSTNPMNAAAQIEAIVS--NMGASKQG 320
                                              :.|..||...:.....||..|  .|.:.|:.
  Rat  1010 ----------------------------------SAAASSTKKFSCKVCSEAFPSRAEMESHKRA 1040

  Fly   321 HL---------CIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHP 376
            |.         |.:..:.:..   ::.|:..|:..:|.:|..|    ...|...|.:|.|:.||.
  Rat  1041 HAGPAAFKCPDCPFSARQWPE---VRAHMAQHSSLRPHQCNQC----SFASKNKKDLRRHMLTHT 1098

  Fly   377 SSSAGVADGGASGADMDGDVDIEGETDADYQCHVCHKSFPRRRDLQRHMETRHGGHHSHSHSESR 441
            :                         :..:.||||.:.|.|...|:.|::..|.       .:.|
  Rat  1099 N-------------------------EKPFSCHVCGQRFNRNGHLKFHIQRLHS-------IDGR 1131

  Fly   442 SSSTSTSSTTTMT 454
            .:.|||:.....|
  Rat  1132 KTGTSTARAPAQT 1144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 21/111 (19%)
C2H2 Zn finger 323..343 CDD:275368 2/20 (10%)
zf-H2C2_2 336..358 CDD:290200 5/22 (23%)
C2H2 Zn finger 351..371 CDD:275368 5/20 (25%)
zf-C2H2 406..427 CDD:278523 8/21 (38%)
C2H2 Zn finger 408..427 CDD:275368 8/19 (42%)
Zfp335XP_008760782.1 C2H2 Zn finger 468..488 CDD:275368
C2H2 Zn finger 498..518 CDD:275368
zf-H2C2_2 510..535 CDD:290200
C2H2 Zn finger 526..546 CDD:275368
C2H2 Zn finger 565..585 CDD:275368
zf-H2C2_2 578..601 CDD:290200
zf-C2H2 591..613 CDD:278523
C2H2 Zn finger 593..613 CDD:275368
C2H2 Zn finger 624..644 CDD:275368
C2H2 Zn finger 652..673 CDD:275368
C2H2 Zn finger 681..700 CDD:275368
C2H2 Zn finger 1021..1041 CDD:275368 5/20 (25%)
C2H2 Zn finger 1049..1069 CDD:275368 2/23 (9%)
zf-H2C2_5 1075..1097 CDD:290620 7/26 (27%)
C2H2 Zn finger 1077..1097 CDD:275368 7/24 (29%)
zf-H2C2_2 1089..1114 CDD:290200 9/50 (18%)
C2H2 Zn finger 1105..1126 CDD:275368 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.