DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and Zfp91

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001162591.1 Gene:Zfp91 RGDID:628736 Length:568 Species:Rattus norvegicus

Alignment Length:114 Identity:26/115 (23%)
Similarity:47/115 (41%) Gaps:31/115 (27%)


  Fly   318 KQGHLCIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHPSSSAGV 382
            ::.::|.||.:.:...:.|.:|...|||.|||:|:.|.......::||.|::.|           
  Rat   367 QRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKH----------- 420

  Fly   383 ADGGASGADMDGDVDIEGETDADYQ--CHVCHKSFPRRRDLQRHMETRH 429
                              :.|:.||  |::|.|.|.::..:..|....|
  Rat   421 ------------------DADSFYQFSCNICGKKFEKKDSVVAHKAKSH 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 17/62 (27%)
C2H2 Zn finger 323..343 CDD:275368 5/20 (25%)
zf-H2C2_2 336..358 CDD:290200 10/22 (45%)
C2H2 Zn finger 351..371 CDD:275368 5/20 (25%)
zf-C2H2 406..427 CDD:278523 7/23 (30%)
C2H2 Zn finger 408..427 CDD:275368 5/19 (26%)
Zfp91NP_001162591.1 zf-C2H2_8 311..388 CDD:292531 4/21 (19%)
C2H2 Zn finger 345..364 CDD:275368
C2H2 Zn finger 372..392 CDD:275368 5/20 (25%)
zf-H2C2_2 384..409 CDD:290200 10/25 (40%)
C2H2 Zn finger 400..420 CDD:275368 5/20 (25%)
C2H2 Zn finger 430..446 CDD:275368 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.