DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and Zfp646

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_766337.2 Gene:Zfp646 MGIID:3665412 Length:1788 Species:Mus musculus

Alignment Length:352 Identity:79/353 (22%)
Similarity:118/353 (33%) Gaps:109/353 (31%)


  Fly   148 AREDEIVAWFGEELVLLMGIPF---LTPLNIQGNSR------YMCHLCHLTFETPHPLKIHLALG 203
            |::|      |||   ..|||.   ..|.|:..:.|      :.|..|...|.....|:.|:...
Mouse    34 AKQD------GEE---ADGIPHPYGSHPENLANHQRNHETLFFPCTTCGKDFSNRLALQSHMRTH 89

  Fly   204 CGRSAMDILWMRLH---YALKAAARSHTETQHSPIPATSS--------------TSSASPTHSPP 251
            ...|      .|.|   :|::.|....:||.     ||.|              |.....||...
Mouse    90 APES------HRRHGPPHAMETAPHLGSETM-----ATDSWGQRLGSGEGWENQTKLVRETHDWE 143

  Fly   252 PQMPPRFSAFR---PIAALTQSLPMVPVTTAATPLSYLPSMSM-ATAPLSTNPMNAAAQI----- 307
            ....||.::..   |.....|.|.|.|.:...| ..::|::|. ..:||.|...|..:.:     
Mouse   144 SGADPRAASGTWEDPPTKQRQGLEMQPDSKGGT-ADWVPAVSSEGASPLPTPASNLLSNLEQYLA 207

  Fly   308 EAIVSNMGA----------SKQGHLCIYCGKVYSRKYGLKIHIRTHT-GFKPLKCKFCLRPFGDP 361
            |::|:...|          .::.:.|..|||.|.....|..|.::|| |..|  |..|.:.|.:.
Mouse   208 ESVVNFTEAQEPTEPLPTEGERKYRCSECGKTYKHAGSLTNHRQSHTLGIYP--CSICFKEFSNL 270

  Fly   362 SNLNKHVRLHLQTHPSSSAGVADGGASGADMDGDVDIEGETDADYQCHVCHKSFPRRRDLQRHME 426
            ..|..|.|||.|..|                             |.|..|.::|...|||..|.:
Mouse   271 MALKNHSRLHAQYRP-----------------------------YHCPHCPRAFRLPRDLLEHQQ 306

  Fly   427 TRHGGHH-----------SHSHSESRS 442
            :..|...           ::.|::.||
Mouse   307 SHEGLKQEQPWEDKEMPTTNGHADERS 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 31/117 (26%)
C2H2 Zn finger 323..343 CDD:275368 7/20 (35%)
zf-H2C2_2 336..358 CDD:290200 8/23 (35%)
C2H2 Zn finger 351..371 CDD:275368 7/20 (35%)
zf-C2H2 406..427 CDD:278523 8/21 (38%)
C2H2 Zn finger 408..427 CDD:275368 7/19 (37%)
Zfp646NP_766337.2 C2H2 Zn finger 10..31 CDD:275368
C2H2 Zn finger 69..89 CDD:275368 5/20 (25%)
C2H2 Zn finger 233..253 CDD:275368 7/20 (35%)
C2H2 Zn finger 260..280 CDD:275368 7/20 (35%)
C2H2 Zn finger 288..308 CDD:275368 7/20 (35%)
C2H2 Zn finger 368..388 CDD:275368
C2H2 Zn finger 395..415 CDD:275368
C2H2 Zn finger 459..479 CDD:275368
C2H2 Zn finger 486..506 CDD:275368
C2H2 Zn finger 568..588 CDD:275368
C2H2 Zn finger 608..628 CDD:275368
C2H2 Zn finger 635..655 CDD:275368
C2H2 Zn finger 808..828 CDD:275368
C2H2 Zn finger 835..855 CDD:275368
C2H2 Zn finger 868..886 CDD:275368
C2H2 Zn finger 1037..1057 CDD:275368
C2H2 Zn finger 1064..1084 CDD:275368
C2H2 Zn finger 1172..1192 CDD:275368
C2H2 Zn finger 1199..1219 CDD:275368
C2H2 Zn finger 1227..1247 CDD:275368
C2H2 Zn finger 1268..1285 CDD:275368
C2H2 Zn finger 1295..1315 CDD:275368
C2H2 Zn finger 1500..1518 CDD:275368
C2H2 Zn finger 1526..1544 CDD:275368
C2H2 Zn finger 1552..1572 CDD:275368
C2H2 Zn finger 1642..1662 CDD:275368
zf-C2H2_8 1668..1742 CDD:292531
C2H2 Zn finger 1669..1689 CDD:275368
zf-H2C2_2 1681..1706 CDD:290200
C2H2 Zn finger 1697..1717 CDD:275368
C2H2 Zn finger 1726..1746 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.