DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and ZNF507

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001129628.1 Gene:ZNF507 HGNCID:23783 Length:953 Species:Homo sapiens

Alignment Length:509 Identity:90/510 (18%)
Similarity:160/510 (31%) Gaps:156/510 (31%)


  Fly    12 QKRSASLIFRIEQLLPSTSITPTSMTTSSTETTL--TATTSTASPAKRMRMSNPRPGVYASQYTP 74
            ::|:.|...|:..|.....:|........|...|  ....:...|....|..:.....|:...:|
Human   482 RRRTNSESLRLHSLAAEALVTMPIRAAELTRANLGHYGDINLLDPDTSQRQVDSTLAAYSKMMSP 546

  Fly    75 KDTCSMAIPTSALLGSTVMPTDGSRSHCQLSNGELI--VSGSLLRQIKLSEDVYSFNAIFELHGG 137
            ....|..:.:.....||::.....|.  :||:|::.  :|.|||..|:                 
Human   547 LKNSSDGLTSLNQSNSTLVALPEGRQ--ELSDGQVKTGISMSLLTVIE----------------- 592

  Fly   138 QVRVRLVRDVAREDEIVAWFGEELVLLMGIPFLTPLNIQGNS----------RYMCHLCHLTFET 192
            ::|.|..:: |.:|:|:    :||.........:..::.||:          .|.|.|||.|...
Human   593 KLRERTDQN-ASDDDIL----KELQDNAQCQPNSDTSLSGNNVVEYIPNAERPYRCRLCHYTSGN 652

  Fly   193 PHPLKIHLALGCGR-------------SAMDILWMRLHYA---------------LKAAARSHTE 229
            ...:|.||.:...|             ::.|:....:|:.               .|:..|:|..
Human   653 KGYIKQHLRVHRQRQPYQCPICEHIADNSKDLESHMIHHCKTRIYQCKQCEESFHYKSQLRNHER 717

  Fly   230 TQHSPIPATSSTSSASPTHSPPPQMPPRFSAFRPIAALTQSLPMVPVTTAATPLSYLPSMSMATA 294
            .||| :|.|.|.::::         .||.|:........|.                        
Human   718 EQHS-LPDTLSIATSN---------EPRISSDTADGKCVQE------------------------ 748

  Fly   295 PLSTNPMNAAAQIEAIVSNMGASKQGHLCIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFG 359
                             .|..:.::.:.|..|....:...|::.|.|.|...||.:|..|.....
Human   749 -----------------GNKSSVQKQYRCDVCDYTSTTYVGVRNHRRIHNSDKPYRCSLCGYVCS 796

  Fly   360 DPSNLNKHVRLHL--------QTHPSSSAGVADGGASGADMDGDVDIEGETDADYQCHVCHKSFP 416
            .|.:|..|:..|.        |.:.:.:..::..|                      .|..|| |
Human   797 HPPSLKSHMWKHASDQNYNYEQVNKAINDAISQSG----------------------RVLGKS-P 838

  Fly   417 RRRDLQRHMETRH----GGHHSHSHSESRSSSTS----TSSTTTMTATVTTSTS 462
            .:..|:...|:..    ...::.|.||..|.:.|    |:....::.|..||.|
Human   839 GKTQLKSSEESADPVTGSSENAVSSSELMSQTPSEVLGTNENEKLSPTSNTSYS 892

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 16/108 (15%)
C2H2 Zn finger 323..343 CDD:275368 5/20 (25%)
zf-H2C2_2 336..358 CDD:290200 7/22 (32%)
C2H2 Zn finger 351..371 CDD:275368 5/20 (25%)
zf-C2H2 406..427 CDD:278523 6/21 (29%)
C2H2 Zn finger 408..427 CDD:275368 6/19 (32%)
ZNF507NP_001129628.1 C2H2 Zn finger 643..663 CDD:275368 8/20 (40%)
C2H2 Zn finger 671..691 CDD:275368 2/20 (10%)
zf-H2C2_2 683..708 CDD:290200 2/25 (8%)
C2H2 Zn finger 699..717 CDD:275368 3/18 (17%)
C2H2 Zn finger 760..780 CDD:275368 5/20 (25%)
zf-H2C2_2 773..797 CDD:290200 7/24 (29%)
C2H2 Zn finger 788..808 CDD:275368 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.