DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdm13 and Zfp521

DIOPT Version :9

Sequence 1:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_663467.1 Gene:Zfp521 / 225207 MGIID:95459 Length:1311 Species:Mus musculus


Alignment Length:384 Identity:86/384 - (22%)
Similarity:126/384 - (32%) Gaps:136/384 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 GEELVLLMGIPFLTPLNIQGNSRYMCHLCHLTFETPHPLKIHLALGCGRSAMDILWMRLHYALKA 222
            ||||              :.::.:.|..|...||               |..||...::|   :.
Mouse    38 GEEL--------------EEDAVHSCDSCLQVFE---------------SLSDITEHKIH---QC 70

  Fly   223 AARSHTETQHSPI---PATSSTS--SASPTHSP---------PPQMPPRFSAFRPIAALTQSLPM 273
            ......:.:..|.   ||:|.:|  ..||:|..         .|.:|               .|.
Mouse    71 QLTDGVDVEDDPSCSWPASSPSSKDQTSPSHGEGCDFGEEEGGPGLP---------------YPC 120

  Fly   274 VPVTTAATPLSY-----------LPSMSMATAPLSTNPMNAAAQIEAIVSNMGASKQGHLCIYCG 327
            .....:.:.|||           ||......:.|..:..:....|:....:    |:.| |..|.
Mouse   121 QFCDKSFSRLSYLKHHEQSHSDKLPFKCTYCSRLFKHKRSRDRHIKLHTGD----KKYH-CSECD 180

  Fly   328 KVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHPSSSAGVADGGASGADM 392
            ..:||...||||::|||..||.||..|.|.|...|:|:.|:::|.:.        .||..||:.|
Mouse   181 AAFSRSDHLKIHLKTHTSNKPYKCAVCRRGFLSSSSLHGHMQVHERN--------KDGSQSGSRM 237

  Fly   393 ------------------DGDVDIE------------GETDADYQCHVCHKSFPRRRDLQRHMET 427
                              |...|::            .|..|..||..||:.|.....|..|:|.
Mouse   238 EDWKMKDTQKCSQCEEGFDFPEDLQKHIAECHPECSPNEDRAALQCMYCHELFVEETSLMNHIEQ 302

  Fly   428 RHGGH--------------------HSHSHSESRSSSTSTS-STTTMTATVTTSTSKSS 465
            .|||.                    |..||.:..|.:.|.| |..|:..|..:||:..|
Mouse   303 VHGGEKKNSCSICSESFLTVEELYSHMDSHQQPESCNHSNSPSLVTVGYTSVSSTTPDS 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 31/110 (28%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
zf-H2C2_2 336..358 CDD:290200 13/21 (62%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-C2H2 406..427 CDD:278523 7/20 (35%)
C2H2 Zn finger 408..427 CDD:275368 6/18 (33%)
Zfp521NP_663467.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..108 8/26 (31%)
COG5048 <83..236 CDD:227381 45/180 (25%)
C2H2 Zn finger 120..140 CDD:275368 3/19 (16%)
C2H2 Zn finger 148..168 CDD:275368 2/19 (11%)
C2H2 Zn finger 176..196 CDD:275368 8/19 (42%)
C2H2 Zn finger 204..224 CDD:275368 7/19 (37%)
C2H2 Zn finger 248..265 CDD:275368 2/16 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..398 2/5 (40%)
C2H2 Zn finger 407..428 CDD:275368
C2H2 Zn finger 439..460 CDD:275368
C2H2 Zn finger 479..498 CDD:275368
C2H2 Zn finger 636..656 CDD:275368
C2H2 Zn finger 666..686 CDD:275368
C2H2 Zn finger 696..713 CDD:275368
C2H2 Zn finger 724..745 CDD:275368
C2H2 Zn finger 754..774 CDD:275368
C2H2 Zn finger 785..805 CDD:275368
C2H2 Zn finger 811..829 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 863..883
C2H2 Zn finger 888..909 CDD:275368
C2H2 Zn finger 932..952 CDD:275368
C2H2 Zn finger 961..981 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1105..1136
C2H2 Zn finger 1227..1247 CDD:275368
C2H2 Zn finger 1258..1279 CDD:275368
C2H2 Zn finger 1288..1307 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.