DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and spr-3

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001024367.1 Gene:spr-3 WormBaseID:WBGene00005008 Length:684 Species:Caenorhabditis elegans

Alignment Length:384 Identity:78/385 (20%)
Similarity:127/385 (33%) Gaps:130/385 (34%)


  Fly   101 HCQLSNGELIVSGSLLRQIKLSEDVYSFNAIFELHGGQVRVRLVRDVAREDEIVAWFGEELVLLM 165
            |...|:.||:.||.|:|..| :||..:...|.|      |...|.|.|.:.|.::.|.|.     
 Worm    66 HLLQSHPELVESGPLVRMFK-NEDEDAPMPILE------READVSDDAVKYEALSSFSEP----- 118

  Fly   166 GIPFLTPLNIQGNSRYMCHLCHLTF------------------ETPHPLKIH-----LALGCGR- 206
                 .|::      |.|.||..||                  :.|..||..     .|||..| 
 Worm   119 -----EPIS------YKCPLCISTFGSHARAVYHILSHRVKLYQAPKSLKFFSRKTMQALGGFRL 172

  Fly   207 -SAMDILWMRLHYALKAAARSHTET----------QHSPIPATSSTSSASPTHSPPPQMPPRFSA 260
             |.:.|.| ||.|..::.....|..          :|...|...|.:            |...|:
 Worm   173 ESQLMIKW-RLQYDNRSVDEKRTRLWRYMEENFGHEHLKQPKLESDN------------PSTSSS 224

  Fly   261 FRPIAALTQSLPMVPVTTAATPLSYLPSMSMATAPLSTNPMNAAAQIEAIVSNMGASKQGHLCIY 325
            |.....|..|                                      :|:..       .|.:.
 Worm   225 FESQTNLNDS--------------------------------------SIIKK-------KLVMK 244

  Fly   326 CGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHPSSSAGVADGGASGA 390
            ||.|:.::.   ||..|    :...|:.|.....:.|:|.:|.|.|:|....|...:|...:|.:
 Worm   245 CGTVFGQRL---IHDNT----QYYLCRNCPYVSWNVSSLWRHFRHHIQKSKQSWTCIACSYSSSS 302

  Fly   391 DMDGDVDIE-----GETDADYQCHVCHKSFPRRRDLQR--HMETRHGGHHSHSHSESRS 442
            .:..|:.::     .|.|.::...:.::....:.||.:  :.:.:..|.:..:||:.||
 Worm   303 RVKIDLHVKMHKEMPEIDLEFATWLRYERRINKNDLNKPTNKKKKPDGGNGSNHSDMRS 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 17/100 (17%)
C2H2 Zn finger 323..343 CDD:275368 6/20 (30%)
zf-H2C2_2 336..358 CDD:290200 5/22 (23%)
C2H2 Zn finger 351..371 CDD:275368 6/20 (30%)
zf-C2H2 406..427 CDD:278523 2/23 (9%)
C2H2 Zn finger 408..427 CDD:275368 2/21 (10%)
spr-3NP_001024367.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.