DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdm13 and lin-13

DIOPT Version :9

Sequence 1:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_498678.3 Gene:lin-13 / 176083 WormBaseID:WBGene00003002 Length:2248 Species:Caenorhabditis elegans


Alignment Length:325 Identity:67/325 - (20%)
Similarity:100/325 - (30%) Gaps:127/325 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 AAARSHTETQHSPI------------PATSSTSSASPTHSPPPQMPPRFSAFRPIAALTQSLPMV 274
            ||.||..:|..|.:            |:..::.:.:...:||.|.|||    |.:.|        
 Worm  1857 AAPRSSLQTNGSSMGSVTTNGGRVVRPSPPNSMNVTLRRAPPQQAPPR----RIVIA-------- 1909

  Fly   275 PVTTAATPLSYLPSMSMATAPLSTNPM-NAAA----------------QIEAIVSNMGASKQGHL 322
                             .:||.:||.: |..|                :.:..:.:|.:|.....
 Worm  1910 -----------------NSAPNNTNVLRNHVAVTTKCQFKDCDKVLHSEFDRQLHSMHSSNSSWF 1957

  Fly   323 CIYCGKVYSRKYGLKIH-IRTH----------TGFKP----LKC--KFCLRP-FGDPSNLNKHVR 369
            |..||.....:..|.:| |:.|          ..||.    |||  :.|..| |..|....||:|
 Worm  1958 CRQCGHSPKSEIDLFLHYIQVHLKPAYDKHQSNSFKSNVFHLKCPIRSCTSPEFQSPKAFEKHMR 2022

  Fly   370 L-------------------------HLQTHPS--SSAGVADGGASGADMDGDVDI-----EGET 402
            .                         |.|.|.|  .|.|.   .||...:.|.:.:     :..|
 Worm  2023 TAHAAELPFEASCCDARFASKALCVKHDQEHASFLDSNGT---DASCCPICGSLSMWSLPKDPHT 2084

  Fly   403 DA----------DYQ--CHVCHKSFPRRRDLQRHMETRH--GGHHSHSHSESRSSSTSTSSTTTM 453
            |.          ||:  |..|.|.||  .|:.:.....|  ..|....|..:...:..|:.|.|:
 Worm  2085 DCLQSHIIRHGLDYRSSCRQCLKQFP--ADVNQDQVIAHILDTHGMSMHGNTFHCNLCTTGTKTV 2147

  Fly   454  453
             Worm  2148  2147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 31/161 (19%)
C2H2 Zn finger 323..343 CDD:275368 6/20 (30%)
zf-H2C2_2 336..358 CDD:290200 11/39 (28%)
C2H2 Zn finger 351..371 CDD:275368 8/47 (17%)
zf-C2H2 406..427 CDD:278523 7/22 (32%)
C2H2 Zn finger 408..427 CDD:275368 6/18 (33%)
lin-13NP_498678.3 C2H2 Zn finger 961..982 CDD:275368
C2H2 Zn finger 986..1003 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.