DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdm13 and ZNF366

DIOPT Version :9

Sequence 1:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_689838.1 Gene:ZNF366 / 167465 HGNCID:18316 Length:744 Species:Homo sapiens


Alignment Length:317 Identity:68/317 - (21%)
Similarity:105/317 - (33%) Gaps:79/317 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 LNIQGNSRYMCHLCHLTF-ETPH---------PLKIHLALGCGRSAMDILWMRLHYALKAAARS- 226
            |..||...:.|.:||..| :|.|         .:|.|....|||.......::.|.|..|:.|. 
Human   301 LTHQGTRPHKCQVCHKAFTQTSHLKRHMMQHSEVKPHNCRVCGRGFAYPSELKAHEAKHASGREN 365

  Fly   227 -----------------HTETQHSPIPATSSTSSASPTHSPPPQMP---PRFSAFRPIAALTQSL 271
                             |..|...||  ..:.|....|...|.|:.   .:....||.......:
Human   366 ICVECGLDFPTLAQLKRHLTTHRGPI--QYNCSECDKTFQYPSQLQNHMMKHKDIRPYICSECGM 428

  Fly   272 PMVPVTTAATPLSYLPSMSMATAPLSTNPMNAAAQIEAIVSNM------GASKQGHLCIYCGKVY 330
            ..|..       .:|...|:....:..:......:...:::||      ..:.:.:.|..|.|.:
Human   429 EFVQP-------HHLKQHSLTHKGVKEHKCGICGREFTLLANMKRHVLIHTNIRAYQCHLCYKSF 486

  Fly   331 SRKYGLKIHIRTHTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHPSSSAGVADGGASGADMDGD 395
            .:|..||.|:..|:..||.|||.|.:.|....||..|:.||..:.|                   
Human   487 VQKQTLKAHMIVHSDVKPFKCKLCGKEFNRMHNLMGHMHLHSDSKP------------------- 532

  Fly   396 VDIEGETDADYQCHVCHKSFPRRRDLQRHMETRHG----GHHSHSHSESRSSSTSTS 448
                      ::|..|...|..:.:|.|||:.:||    |.||......|.:...|:
Human   533 ----------FKCLYCPSKFTLKGNLTRHMKVKHGVMERGLHSQGLGRGRIALAQTA 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 25/105 (24%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
zf-H2C2_2 336..358 CDD:290200 10/21 (48%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-C2H2 406..427 CDD:278523 7/20 (35%)
C2H2 Zn finger 408..427 CDD:275368 7/18 (39%)
ZNF366NP_689838.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..228
COG5048 253..>549 CDD:227381 57/285 (20%)
C2H2 Zn finger 255..275 CDD:275368
C2H2 Zn finger 283..303 CDD:275368 1/1 (100%)
C2H2 Zn finger 311..331 CDD:275368 6/19 (32%)
C2H2 Zn finger 339..359 CDD:275368 5/19 (26%)
C2H2 Zn finger 367..387 CDD:275368 1/19 (5%)
C2H2 Zn finger 395..415 CDD:275368 4/19 (21%)
C2H2 Zn finger 423..443 CDD:275368 3/26 (12%)
C2H2 Zn finger 451..471 CDD:275368 2/19 (11%)
Interaction with NRIP1. /evidence=ECO:0000269|PubMed:17085477 455..744 37/154 (24%)
C2H2 Zn finger 479..499 CDD:275368 7/19 (37%)
C2H2 Zn finger 507..527 CDD:275368 7/19 (37%)
C2H2 Zn finger 535..554 CDD:275368 7/18 (39%)
PXDLS. /evidence=ECO:0000269|PubMed:16393996, ECO:0000269|PubMed:17085477 590..594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 603..627
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 664..692
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.