DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and znf462

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_012808421.1 Gene:znf462 XenbaseID:XB-GENE-976911 Length:2481 Species:Xenopus tropicalis

Alignment Length:387 Identity:76/388 (20%)
Similarity:128/388 (33%) Gaps:120/388 (31%)


  Fly   114 SLLRQIKLSEDVYSFNAIFELHGGQVRVRLVRDVAREDEIVAWFGEELVLLMG--IPFLTPLNIQ 176
            |:|..|...:||.|..|.:......:.|....|          .|::.:|..|  :|..|..:..
 Frog  1348 SVLFNIIKEKDVNSEEASYSAEKPTINVEPQMD----------SGDDFILSQGKTLPLQTNNSAL 1402

  Fly   177 GNSRYMCHLCHLTFETPHPLKIHLAL---GCGRSAMDI-------------------LWMRLHYA 219
            .:|.|:|.:||..:...|.|..|...   |....|.|.                   :..|:|..
 Frog  1403 SSSPYLCTVCHSEYNNLHGLLTHYGKKHPGMKVKAADFAQEVDINPGAVYKCRHCPYINTRIHGV 1467

  Fly   220 LKAAARSHTETQHSPIPAT----------SSTSSASPTHSPPPQMPPRFSAFRPIAALTQSLPMV 274
            |     :|.:.:|..:..|          |:..|.:.:..........:.|:|     .:..|..
 Frog  1468 L-----THYQKRHPSVKVTAEDFVHDVEQSTEMSQNESDENSRIFKQGYGAYR-----CKICPYT 1522

  Fly   275 PVTTAATPLSY-----LPSMSMATAP-----------LSTNPMNAAAQIEAIVSNMGASKQGHLC 323
            ..|.....:.|     .|...|.::|           |..:|......:||.|.. |.:|     
 Frog  1523 HGTLEKLKIHYEKYHDQPEPDMLSSPKDFASVETDVLLDEHPPQTVVTLEAAVVK-GPTK----- 1581

  Fly   324 IYCGKVYSRKYGLKIHIRTHTGFKPLKCK-FCLRPFGDPSNLNKHVRL---HLQTHPSSSAGVAD 384
                  |.|.     |:..||.|:...|| ||....|    :.:|.|:   :::..|        
 Frog  1582 ------YKRN-----HMAPHTVFRCQLCKYFCSTRKG----IARHYRIKHNNVRAQP-------- 1623

  Fly   385 GGASGADMDGDVDIEGETDADYQCHVCHKSFPRRRDLQRHMETRH--GGHHSHSHSESRSSS 444
                          ||:.:. ::|.:|..:.|.|:.|..|.:.||  ..:::|..:.||:.|
 Frog  1624 --------------EGKNNL-FKCALCSYTNPIRKGLAAHYQKRHDIDAYYTHCLAASRTVS 1670

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 25/120 (21%)
C2H2 Zn finger 323..343 CDD:275368 3/20 (15%)
zf-H2C2_2 336..358 CDD:290200 8/23 (35%)
C2H2 Zn finger 351..371 CDD:275368 7/24 (29%)
zf-C2H2 406..427 CDD:278523 6/21 (29%)
C2H2 Zn finger 408..427 CDD:275368 6/19 (32%)
znf462XP_012808421.1 C2H2 Zn finger 1986..2006 CDD:275370
C2H2 Zn finger 2020..2040 CDD:275368
C2H2 Zn finger 2049..2070 CDD:275368
C2H2 Zn finger 2078..2099 CDD:275368
C2H2 Zn finger 2244..2264 CDD:275368
C2H2 Zn finger 2290..2310 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.