DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and prdm13

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_002932206.1 Gene:prdm13 XenbaseID:XB-GENE-960155 Length:632 Species:Xenopus tropicalis

Alignment Length:660 Identity:148/661 (22%)
Similarity:211/661 (32%) Gaps:303/661 (46%)


  Fly    67 VYASQYTPKDTCSMAIPTSALLGSTV-----------MPTDGSRSHCQLSNGELIVSG------- 113
            :||      |.|   ||....||..:           ....|.:...:...|:|:...       
 Frog    11 IYA------DNC---IPAGLRLGPIMGIFKLGKYLSDRREPGPKKKVRFVRGDLLDEAGGPATEW 66

  Fly   114 -SLLRQIKLSEDVYSFNAIFELHGGQVRVRLVRDVAREDEIVAWFGEELVLLMGI-PFLTPLNIQ 176
             .|:|..:.::: ....||.:|.|||:..|.:|||...:|:..|:...|.....| ...||.:.:
 Frog    67 MGLIRAARNNQE-QILEAISDLPGGQIYYRTLRDVQPGEELTVWYSSSLAQWFDISTTATPTHDE 130

  Fly   177 -GNSRYMCHLCHLTFETPHPLKIH----------------------------------------- 199
             |..||:|..|..||:.|:.||.|                                         
 Frog   131 KGEERYICWYCWRTFKFPNTLKAHVHFHCSLNSSRGFLHNDQIRTSQSFSASPKISEGVSNTAPP 195

  Fly   200 ------LALGCGR------SAMDILWMRLHYALKAAARSHTE----------------------- 229
                  ||.|..|      :::..:..:|....||..:.|.|                       
 Frog   196 LRTNPQLANGASRDSIKREASLSPVLSKLGVIKKALGKEHQERALDMSVGSTRNHSQFIGIVGNA 260

  Fly   230 ------------------TQHSPIPATSST----------------------------------- 241
                              |..|.:|.|.|.                                   
 Frog   261 CGGNGMAFYPGIRSAFKPTGLSKLPHTDSAREDSKATSMGFSKLLGGIKPSRPGSEALISSHQSK 325

  Fly   242 -----------------------------------------SSASPT----HSPPP-------QM 254
                                                     ::.|||    |.|..       .:
 Frog   326 CLSTGDGSSSILSCATGLRGFPILSHLEETSAFKHVERGVHANLSPTSRYNHMPSAGLHFERFSI 390

  Fly   255 PPRFSAFRPIAALTQSLPMVPVTT------AATP-----------LSYLPSMSMATAPLSTNP-- 300
            || |...:..:| ..::|::|.|.      .:||           :.|..|:|...|..:.||  
 Frog   391 PP-FEGMKSYSA-ECNIPVMPFTVYNGELLYSTPYYPFKFHFSNLIKYPESVSYFNAGPAINPEL 453

  Fly   301 ------------------------MNAAAQIEAI----VSNMGASKQGHLCIYCGKVYSRKYGLK 337
                                    .....:||::    .|..|..|:||||:||||:||||||||
 Frog   454 GSIASSIDRELAMHSHQLSEIASEKGRGGRIESLAAGAASATGKPKKGHLCLYCGKLYSRKYGLK 518

  Fly   338 IHIRTHTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHPSSSAGVADGGASGADMDGDVDIEGET 402
            ||:|||||:||||||.||||||||||||||:|||                          .||.|
 Frog   519 IHMRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLH--------------------------AEGNT 557

  Fly   403 DADYQCHVCHKSFPRRRDLQRHMETRHGG-----------HHSHSHSESRSSSTSTSSTTTMT-- 454
              .|:|..|.|...|||||:||:::||.|           ...:|.::.:|....:......|  
 Frog   558 --PYRCEHCGKVLVRRRDLERHVKSRHPGQTLSSKEQDPAEQQYSQADPKSEDNDSEVDVCFTDE 620

  Fly   455 -ATVTTSTSK 463
             :...|.:||
 Frog   621 QSDPETGSSK 630

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 59/141 (42%)
C2H2 Zn finger 323..343 CDD:275368 17/20 (85%)
zf-H2C2_2 336..358 CDD:290200 19/22 (86%)
C2H2 Zn finger 351..371 CDD:275368 18/20 (90%)
zf-C2H2 406..427 CDD:278523 11/21 (52%)
C2H2 Zn finger 408..427 CDD:275368 10/19 (53%)
prdm13XP_002932206.1 SET 11..110 CDD:279228 25/109 (23%)
C2H2 Zn finger 504..524 CDD:275368 17/20 (85%)
zf-C2H2 504..524 CDD:278523 17/20 (85%)
zf-H2C2_2 517..539 CDD:290200 19/22 (86%)
C2H2 Zn finger 532..552 CDD:275368 18/20 (90%)
C2H2 Zn finger 561..579 CDD:275368 10/18 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D489976at33208
OrthoFinder 1 1.000 FOG0008045
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.