DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdm13 and znf827

Sequence 1:NP_648032.1 Gene:Prdm13 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_002938981.2 Gene:znf827 XenbaseID:XB-GENE-1033048 Length:1318 Species:Xenopus tropicalis

Alignment Length:602 Identity:105/603 (17%)
Similarity:193/603 (32%) Gaps:232/603 (38%)


  Fly     6 QLDSLEQKRSASLIFRI----EQLLPSTSITPTSM--TTSSTETTLTATTSTASPAKRMRMSNPR 64
            :|.:..||...:|.|::    |...|.:|::|.|:  ....:|..|::|     |.:..:....:
 Frog   560 KLSAANQKEPLTLTFKVKDEPEDEEPISSLSPQSLYGFNQESEGRLSST-----PDEDSKPQETQ 619

  Fly    65 PGVYA---------------SQYTPKDTCSMA---------IPTSAL-----LGSTVMPTDGSRS 100
            |.:..               |..:.|||.|:.         ||.|::     :|.:.:.......
 Frog   620 PNLLTQDISMKAASELLMKLSAESCKDTQSVKIKEEPMEVDIPDSSISPRQNIGYSTLLRQEKNE 684

  Fly   101 HCQ-LSNGELIVSGSLLRQ---IKLSEDVYSFNAIFEL-------HGGQVRVRLVRDVAREDEIV 154
            |.| :....::..|:|..|   :|::.::     :|:|       |..:..|  :|..:      
 Frog   685 HLQKMPLCRVVPEGNLFSQDISVKMASEL-----LFKLSEKVSKEHNHKSNV--IRTTS------ 736

  Fly   155 AWFGEE-------------------------------LVLLMGIPF------LTPLNIQG----- 177
            .:|.||                               |....|||.      |.|.::.|     
 Frog   737 PFFSEEKCRQSPFTSNSKDIVKNEAFPQGRPDSEPMGLDTSSGIPTWKLSEQLFPCDVCGKVFGR 801

  Fly   178 -------------NSRYMCHLC------------HLTF-------------------------ET 192
                         ..:|.||||            |||.                         :|
 Frog   802 QQTLSRHLLLHTEERKYKCHLCSYAAKCRANLNQHLTVHAVKLVSTDTEDIVSAVISETSEKKKT 866

  Fly   193 PHPLKIHLALGCG-RSAMDILW---MRLH-------YAL-----------KAAARSHTETQHSPI 235
            |:....|:   || .:.:::.:   |.||       |::           ::..|:|..|:||..
 Frog   867 PYFYSCHV---CGFETELNVQFVSHMSLHVDKEQWMYSICCSTCDFVTMEESDMRTHISTKHSGE 928

  Fly   236 PATSSTSSASPTHSPPPQMPPRFSAFRPIAALTQSLPMVPVTTAATPLSYLPSMSMATAPLSTNP 300
            ...:.:.|.||:.|             .::.|:.|               ..|...:..||....
 Frog   929 DRKTPSESVSPSSS-------------SLSTLSDS---------------ANSKEDSDTPLRNQT 965

  Fly   301 MNAAAQIEAI------VSNMGASKQGHLCIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFG 359
            .|:...|..:      |||...|.:|..|::|..|...|...:.|::.|...:..:|..|.:...
 Frog   966 SNSLLVISVVPGSQPFVSNEEKSDKGFECVFCNFVCKTKTMFERHLQIHLITRMYECDVCHKFMK 1030

  Fly   360 DPSNLNKHVRLHLQTHPSSSAGVADGG--------ASGADMDGDVDIEGETDADYQCHVCHKSFP 416
            .|..|.:|.:.|.         |..||        ::......:..::.....:|:|.:|.....
 Frog  1031 TPEQLTEHKKCHT---------VPTGGLKCPFCIYSTNRPAAMECHLKTHYKMEYKCRICKTVKA 1086

  Fly   417 RRRDLQRHMETRHGGHH 433
            .:.:|:.|:.....|:|
 Frog  1087 NQLELEMHVRGHRLGNH 1103

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 22/106 (21%)
C2H2 Zn finger 323..343 CDD:275368 5/20 (25%)
zf-H2C2_2 336..358 CDD:290200 4/22 (18%)
C2H2 Zn finger 351..371 CDD:275368 5/20 (25%)
zf-C2H2 406..427 CDD:278523 5/21 (24%)
C2H2 Zn finger 408..427 CDD:275368 4/19 (21%)
znf827XP_002938981.2 COG5048 360..829 CDD:227381 50/287 (17%)
C2H2 Zn finger 364..384 CDD:275368
C2H2 Zn finger 392..412 CDD:275368
C2H2 Zn finger 423..443 CDD:275368
C2H2 Zn finger 792..812 CDD:275370 1/20 (5%)
C2H2 Zn finger 820..840 CDD:275370 7/20 (35%)
C2H2 Zn finger 994..1014 CDD:275368 5/20 (25%)
C2H2 Zn finger 1022..1042 CDD:275368 5/20 (25%)
C2H2 Zn finger 1051..1071 CDD:275368 0/20 (0%)
C2H2 Zn finger 1078..1098 CDD:275368 4/20 (20%)
C2H2 Zn finger 1106..1126 CDD:275368
zf-H2C2_2 1119..1143 CDD:290200
C2H2 Zn finger 1134..1153 CDD:275368
C2H2 Zn finger 1163..1183 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.