DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Cpr100A

DIOPT Version :10

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_651829.1 Gene:Cpr100A / 43657 FlyBaseID:FBgn0039805 Length:241 Species:Drosophila melanogaster


Alignment Length:67 Identity:22/67 - (32%)
Similarity:32/67 - (47%) Gaps:20/67 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DSYSYKFET-SDGTKQEQHGSLKSLGPEEDALQVAGSFSFVGDDGQTHAISYVADENGFQPQGED 98
            |..::|.|| :|||:.                   ||:|::...||...|||.|.:||||..|:.
  Fly    49 DGINFKEETDADGTRH-------------------GSYSYLDPTGQRRTISYTAGKNGFQASGDH 94

  Fly    99 IP 100
            :|
  Fly    95 LP 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:459790 16/55 (29%)
Cpr100ANP_651829.1 Chitin_bind_4 44..88 CDD:459790 17/57 (30%)

Return to query results.
Submit another query.