DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Cpr97Eb

DIOPT Version :10

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster


Alignment Length:108 Identity:33/108 - (30%)
Similarity:46/108 - (42%) Gaps:22/108 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVLACLLSALCLAAAAPDAEIVDLVSDV---------NAD-SYSYKFETSDGTKQEQHGSLKSL 58
            :|.|...|..|.|||.:..|:..|..:.|         |.| ||:|.:|.:|          ||.
  Fly     1 MLKLTLSLGLLLLAAHSAYAQHQDYTTPVPILKQIDKHNDDGSYTYGYEAAD----------KSF 55

  Fly    59 GPEEDAL--QVAGSFSFVGDDGQTHAISYVADENGFQPQGEDI 99
            ..|....  :|.|.:.:|.|.|:...|.|.|.:.||:|.|..|
  Fly    56 KIETKYANGEVYGKYGYVDDQGKVREIEYGASKRGFEPAGSHI 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:459790 15/56 (27%)
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:459790 15/56 (27%)

Return to query results.
Submit another query.