DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and Cpr97Ea

DIOPT Version :10

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster


Alignment Length:134 Identity:34/134 - (25%)
Similarity:54/134 - (40%) Gaps:46/134 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSILVLACLL----------------------------SALCLAAAAPDAEIVDLVSDVNA--- 34
            |:.:|.:.||:                            :|....|.||.|:.|.::..:|.   
  Fly     4 MQRVLFVGCLIVGVGMVRSQDYQDYQENTPRTAPLRLRANAAPARAEAPRADPVAILKQINKHNE 68

  Fly    35 -DSYSYKFETSDGTKQEQHGSLKSLGPEEDAL---QVAGSFSFVGDDGQTHAISYVADENGFQPQ 95
             .||:|.:|.:|       ||.|.    |..|   :|.|.:.:|.:.|:...:.|.|::.||||.
  Fly    69 DGSYTYGYEGAD-------GSFKI----ETKLATGEVKGKYGYVDETGKVRVVEYGANKYGFQPS 122

  Fly    96 GEDI 99
            ||.|
  Fly   123 GEGI 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:459790 15/57 (26%)
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:459790 15/57 (26%)

Return to query results.
Submit another query.