DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Aa and CG8927

DIOPT Version :10

Sequence 1:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster


Alignment Length:89 Identity:20/89 - (22%)
Similarity:34/89 - (38%) Gaps:26/89 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PDAEIVDLVSDVNAD-SYSYKFETSDGT-KQEQHGSLKSLGPEEDALQVAGSFSFVGDDGQTHAI 83
            |.::.:....:.|.| |.::.:|..||: |:|..|:        |.: ..|::.:|..||.....
  Fly   257 PVSQTIRKWREENEDGSITWGYENDDGSFKEELIGT--------DCI-TKGTYGYVDPDGNKREY 312

  Fly    84 SYVA---------------DENGF 92
            .|..               .||||
  Fly   313 HYETGIKCDPNNRNNEEELQENGF 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:459790 14/70 (20%)
CG8927NP_650527.2 Chitin_bind_4 277..336 CDD:459790 14/67 (21%)

Return to query results.
Submit another query.